| UniProt ID | SYSM_YEAST | |
|---|---|---|
| UniProt AC | P38705 | |
| Protein Name | Serine--tRNA ligase, mitochondrial | |
| Gene Name | DIA4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 446 | |
| Subcellular Localization | Mitochondrion matrix . | |
| Protein Description | Catalyzes the attachment of serine to tRNA(Ser). Is also able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec) (By similarity).. | |
| Protein Sequence | MIIRRLFSISNRSFFLKKPQFDVKKIIEMIPQYQTSIQNRELIEADSIIRSLQLLGERYQNIKEIDKVIADIQIQRKSIEAQIKKDKTKITEYSAALKALKEQYNDQNSKSSELKKKILETCKSLPNTLDPTVPLDAPQIEQWINPLKTHKTSEAQAHVDIMLKKNMLDLQTASNVTGMSWYYLLNDGARLEQALVAYALKKANENGFSSCVPPSITKKELIDACGFNPRDMNNERQIYALQDTNLGLVATAEIPLAGLGANKVLELNSGECSKKLVGVSRCYRAEAGARGKDTKGLYRVHEFTKVELFCWSKPETSAKVLEEIKQFQISVVEELGIPAKVLNMPSNDLGNPAFKKYDIEAWMPGRGKFGEISSASNCTDFQSRRLNTKYRDDNTGKLEYVHTLNGTAMAIPRVIVALVENFYDPSTGKISVPECLREFMNGQRYI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of SYSM_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SYSM_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYSM_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYSM_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
