dbPTM

SAE3_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SAE3_YEAST
UniProt AC	P89114
Protein Name	Pachytene arrest protein SAE3
Gene Name	SAE3
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	91
Subcellular Localization	Nucleus . Localizes at chromosomal foci at leptotene and zigotene.
Protein Description	Involved in meiotic DNA-break repair. Required for the recruitment of DCM1 to meiosis recombination hot spots..
Protein Sequence	MNYLETQLNKKQKQIQEYESMNGNLIKMFEQLSKEKKNDETPKKISSTYIKELKEYNELRDAGLRLAQIIADEKQCKIKDVFEEIGYSMKD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
3	Phosphorylation	-----MNYLETQLNK -----CCHHHHHHHH	12.48	21126336
41	Phosphorylation	KEKKNDETPKKISST HHHCCCCCCCCHHHH	43.18	27214570

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SAE3_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SAE3_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SAE3_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RAD24_YEAST	RAD24	physical	11825877
HSM3_YEAST	HSM3	genetic	17314980
TAF5_YEAST	TAF5	genetic	17314980
MEI5_YEAST	MEI5	physical	19270307
DMC1_YEAST	DMC1	physical	19270307
RFA2_YEAST	RFA2	physical	19270307
MEI5_YEAST	MEI5	physical	21543267
RL13A_YEAST	RPL13A	genetic	27708008
PET8_YEAST	PET8	genetic	27708008
REI1_YEAST	REI1	genetic	27708008
GPR1_YEAST	GPR1	genetic	27708008
YD121_YEAST	YDL121C	genetic	27708008
INO2_YEAST	INO2	genetic	27708008
EMC6_YEAST	EMC6	genetic	27708008
COX7_YEAST	COX7	genetic	27708008
TDA1_YEAST	TDA1	genetic	27708008
YBF9_YEAST	YBL059W	genetic	29674565
ICE2_YEAST	ICE2	genetic	29674565
TAD3_YEAST	TAD3	genetic	29674565

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SAE3_YEAST

Related Literatures of Post-Translational Modification