UniProt ID | SAE3_YEAST | |
---|---|---|
UniProt AC | P89114 | |
Protein Name | Pachytene arrest protein SAE3 | |
Gene Name | SAE3 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 91 | |
Subcellular Localization | Nucleus . Localizes at chromosomal foci at leptotene and zigotene. | |
Protein Description | Involved in meiotic DNA-break repair. Required for the recruitment of DCM1 to meiosis recombination hot spots.. | |
Protein Sequence | MNYLETQLNKKQKQIQEYESMNGNLIKMFEQLSKEKKNDETPKKISSTYIKELKEYNELRDAGLRLAQIIADEKQCKIKDVFEEIGYSMKD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SAE3_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SAE3_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SAE3_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RAD24_YEAST | RAD24 | physical | 11825877 | |
HSM3_YEAST | HSM3 | genetic | 17314980 | |
TAF5_YEAST | TAF5 | genetic | 17314980 | |
MEI5_YEAST | MEI5 | physical | 19270307 | |
DMC1_YEAST | DMC1 | physical | 19270307 | |
RFA2_YEAST | RFA2 | physical | 19270307 | |
MEI5_YEAST | MEI5 | physical | 21543267 | |
RL13A_YEAST | RPL13A | genetic | 27708008 | |
PET8_YEAST | PET8 | genetic | 27708008 | |
REI1_YEAST | REI1 | genetic | 27708008 | |
GPR1_YEAST | GPR1 | genetic | 27708008 | |
YD121_YEAST | YDL121C | genetic | 27708008 | |
INO2_YEAST | INO2 | genetic | 27708008 | |
EMC6_YEAST | EMC6 | genetic | 27708008 | |
COX7_YEAST | COX7 | genetic | 27708008 | |
TDA1_YEAST | TDA1 | genetic | 27708008 | |
YBF9_YEAST | YBL059W | genetic | 29674565 | |
ICE2_YEAST | ICE2 | genetic | 29674565 | |
TAD3_YEAST | TAD3 | genetic | 29674565 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...