dbPTM

YD121_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YD121_YEAST
UniProt AC	Q07541
Protein Name	Uncharacterized protein YDL121C
Gene Name	YDL121C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	149
Subcellular Localization	Endoplasmic reticulum membrane Single-pass type II membrane protein .
Protein Description
Protein Sequence	MNLYGYFLLLIIVIAFIALLPLFSGIGTFKLTKPKSSATAQSATGKLGKREYLKKKLDHTNVLKFDLKDTEESLGHDSASASSASRKFEIDSKTGLKRRVIGQYNKDPNDFDFDIDDLINEDELDERREEEKKLKKYNGKKNEAYEGFV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
68	Acetylation	NVLKFDLKDTEESLG CEEECCCCCHHHHHC	65.53	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YD121_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YD121_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YD121_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CHO2_YEAST	CHO2	genetic	16269340
GOSR1_YEAST	GOS1	genetic	16269340
GET3_YEAST	GET3	physical	11283351
ASK10_YEAST	ASK10	genetic	27708008
SIN3_YEAST	SIN3	genetic	27708008
NAA30_YEAST	MAK3	genetic	27708008
YCZ2_YEAST	YCR102C	genetic	27708008
TAPT1_YEAST	EMP65	genetic	27708008
WWM1_YEAST	WWM1	genetic	27708008
YFF2_YEAST	YFL052W	genetic	27708008
LSB3_YEAST	LSB3	genetic	27708008
ATG1_YEAST	ATG1	genetic	27708008
YGZ2_YEAST	YGL242C	genetic	27708008
STF2_YEAST	STF2	genetic	27708008
YG51_YEAST	YGR237C	genetic	27708008
FSH1_YEAST	FSH1	genetic	27708008
NAM8_YEAST	NAM8	genetic	27708008
RE104_YEAST	REC104	genetic	27708008
FMC1_YEAST	FMC1	genetic	27708008
THIK_YEAST	POT1	genetic	27708008
LPLA_YEAST	AIM22	genetic	27708008
TCTP_YEAST	TMA19	genetic	27708008
NNK1_YEAST	NNK1	genetic	27708008
MMM1_YEAST	MMM1	genetic	27708008
LDB18_YEAST	LDB18	genetic	27708008
EIF3J_YEAST	HCR1	genetic	27708008
HMX1_YEAST	HMX1	genetic	27708008
LIPB_YEAST	LIP2	genetic	27708008
GLRX8_YEAST	GRX8	genetic	27708008
YMK8_YEAST	YML108W	genetic	27708008
YM01_YEAST	YMR111C	genetic	27708008
DCAM_YEAST	SPE2	genetic	27708008
DIA2_YEAST	DIA2	genetic	27708008
WHI5_YEAST	WHI5	genetic	27708008
KIN4_YEAST	KIN4	genetic	27708008
RDL1_YEAST	RDL1	genetic	27708008
AIM44_YEAST	AIM44	genetic	27708008
ATG41_YEAST	ICY2	genetic	27708008
YP022_YEAST	YPR022C	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YD121_YEAST

Related Literatures of Post-Translational Modification