UniProt ID | GLRX8_YEAST | |
---|---|---|
UniProt AC | Q05926 | |
Protein Name | Glutaredoxin-8 | |
Gene Name | GRX8 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 109 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Glutathione-dependent oxidoreductase with lower activity compared to the other members of the glutaredoxin family. The disulfide bond functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase.. | |
Protein Sequence | MSAFVTKAEEMIKSHPYFQLSASWCPDCVYANSIWNKLNVQDKVFVFDIGSLPRNEQEKWRIAFQKVVGSRNLPTIVVNGKFWGTESQLHRFEAKGTLEEELTKIGLLP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
66 | Acetylation | KWRIAFQKVVGSRNL HHHHEEHHHHCCCCC | 32.22 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GLRX8_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GLRX8_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GLRX8_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...