UniProt ID | FSH1_YEAST | |
---|---|---|
UniProt AC | P38777 | |
Protein Name | Family of serine hydrolases 1 | |
Gene Name | FSH1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 243 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Serine hydrolase of unknown specificity.. | |
Protein Sequence | MTVQIPKLLFLHGFLQNGKVFSEKSSGIRKLLKKANVQCDYIDAPVLLEKKDLPFEMDDEKWQATLDADVNRAWFYHSEISHELDISEGLKSVVDHIKANGPYDGIVGFSQGAALSSIITNKISELVPDHPQFKVSVVISGYSFTEPDPEHPGELRITEKFRDSFAVKPDMKTKMIFIYGASDQAVPSVRSKYLYDIYLKAQNGNKEKVLAYEHPGGHMVPNKKDIIRPIVEQITSSLQEASE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Acetylation | HGFLQNGKVFSEKSS HHHHHCCCCCCCCCH | 47.89 | 24489116 | |
24 | Acetylation | NGKVFSEKSSGIRKL CCCCCCCCCHHHHHH | 49.04 | 24489116 | |
24 | 2-Hydroxyisobutyrylation | NGKVFSEKSSGIRKL CCCCCCCCCHHHHHH | 49.04 | - | |
122 | Ubiquitination | LSSIITNKISELVPD HHHHHHHHHHHHCCC | 38.67 | 23749301 | |
192 | Acetylation | AVPSVRSKYLYDIYL CCCCHHHHHHHHEEE | 28.80 | 24489116 | |
200 | Acetylation | YLYDIYLKAQNGNKE HHHHEEEEECCCCCC | 30.84 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FSH1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FSH1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FSH1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ATC1_YEAST | PMR1 | genetic | 27708008 | |
HUR1_YEAST | HUR1 | genetic | 27708008 | |
TCTP_YEAST | TMA19 | genetic | 27708008 | |
AVL9_YEAST | AVL9 | genetic | 27708008 | |
SIN3_YEAST | SIN3 | genetic | 27708008 | |
FSH3_YEAST | FSH3 | genetic | 27708008 | |
RU2A_YEAST | LEA1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...