UniProt ID | LCL1_YEAST | |
---|---|---|
UniProt AC | Q02786 | |
Protein Name | Long chronological lifespan protein 1 | |
Gene Name | LCL1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 101 | |
Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor . |
|
Protein Description | ||
Protein Sequence | MKNAALCEALPLLATCSHEIPPTPHTVCFVFPPALLLSPSKLTLLNSRRVASRCVIIIDPRLLRLFSCSRPQQLPRDKNQSFAKPSFSFFFFLLTSLLSPF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LCL1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LCL1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LCL1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RV161_YEAST | RVS161 | genetic | 27708008 | |
RV167_YEAST | RVS167 | genetic | 27708008 | |
VRP1_YEAST | VRP1 | genetic | 27708008 | |
GPT1_YEAST | SCT1 | genetic | 27708008 | |
SLX5_YEAST | SLX5 | genetic | 27708008 | |
TRS85_YEAST | TRS85 | genetic | 27708008 | |
RPA14_YEAST | RPA14 | genetic | 27708008 | |
UME6_YEAST | UME6 | genetic | 27708008 | |
UBP3_YEAST | UBP3 | genetic | 27708008 | |
RAD4_YEAST | RAD4 | genetic | 27708008 | |
SODM_YEAST | SOD2 | genetic | 27708008 | |
GSH1_YEAST | GSH1 | genetic | 27708008 | |
SAC1_YEAST | SAC1 | genetic | 27708008 | |
NU133_YEAST | NUP133 | genetic | 27708008 | |
NKP2_YEAST | NKP2 | genetic | 27708008 | |
VID22_YEAST | VID22 | genetic | 27708008 | |
SCS7_YEAST | SCS7 | genetic | 27708008 | |
PT127_YEAST | PET127 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...