| UniProt ID | HIS4_YEAST | |
|---|---|---|
| UniProt AC | P40545 | |
| Protein Name | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase | |
| Gene Name | HIS6 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 261 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Catalyzes the isomerization of the aminoaldose moiety of ProFAR to the aminoketose of PRFAR.. | |
| Protein Sequence | MTKFIGCIDLHNGEVKQIVGGTLTSKKEDVPKTNFVSQHPSSYYAKLYKDRDVQGCHVIKLGPNNDDAAREALQESPQFLQVGGGINDTNCLEWLKWASKVIVTSWLFTKEGHFQLKRLERLTELCGKDRIVVDLSCRKTQDGRWIVAMNKWQTLTDLELNADTFRELRKYTNEFLIHAADVEGLCGGIDELLVSKLFEWTKDYDDLKIVYAGGAKSVDDLKLVDELSHGKVDLTFGSSLDIFGGNLVKFEDCCRWNEKQG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 22 | Phosphorylation | VKQIVGGTLTSKKED EEEEECCCCCCCCCC | 22.42 | 22369663 | |
| 24 | Phosphorylation | QIVGGTLTSKKEDVP EEECCCCCCCCCCCC | 38.04 | 22369663 | |
| 25 | Phosphorylation | IVGGTLTSKKEDVPK EECCCCCCCCCCCCC | 44.86 | 22369663 | |
| 26 | Acetylation | VGGTLTSKKEDVPKT ECCCCCCCCCCCCCC | 55.75 | 24489116 | |
| 32 | Acetylation | SKKEDVPKTNFVSQH CCCCCCCCCCCCCCC | 56.82 | 25381059 | |
| 46 | Acetylation | HPSSYYAKLYKDRDV CCCHHHHHHHCCCCC | 35.91 | 24489116 | |
| 216 | Acetylation | IVYAGGAKSVDDLKL EEEECCCCCHHHHHH | 55.04 | 24489116 | |
| 222 | Acetylation | AKSVDDLKLVDELSH CCCHHHHHHHHHHCC | 54.16 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HIS4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HIS4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HIS4_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SC160_YEAST | SCP160 | physical | 16554755 | |
| YL179_YEAST | YLR179C | physical | 16554755 | |
| HDA1_YEAST | HDA1 | genetic | 21288874 | |
| HDA2_YEAST | HDA2 | genetic | 21288874 | |
| PSA3_YEAST | PRE9 | genetic | 21288874 | |
| RPN10_YEAST | RPN10 | genetic | 21288874 | |
| COG4_YEAST | COG4 | genetic | 21288874 | |
| UBP8_YEAST | UBP8 | genetic | 21288874 | |
| SWR1_YEAST | SWR1 | genetic | 21288874 | |
| VPS72_YEAST | VPS72 | genetic | 21288874 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
