UniProt ID | YL179_YEAST | |
---|---|---|
UniProt AC | Q06252 | |
Protein Name | Uncharacterized protein YLR179C | |
Gene Name | YLR179C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 201 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSSAIVAKLNKEDIIKDTVKDLAFEILGELSVSYVDSDDIKLGNPMPMEATQAAPTIKFTPFDKSQLSAEDKLALLMTDPDAPSRTEHKWSEVCHYIITDIPVEYGPGGDIAISGKGVVRNNYIGPGPPKNSGYHRYVFFLCKQPKGADSSTFTKVENIISWGYGTPGAGAYDYIKENNLQLVGANYYMVENTTVDFNYDM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSSAIVAKL ------CCHHHHHHC | 28.60 | 19823750 | |
3 | Phosphorylation | -----MSSAIVAKLN -----CCHHHHHHCC | 22.25 | 19795423 | |
8 | Acetylation | MSSAIVAKLNKEDII CCHHHHHHCCHHHHH | 41.52 | 22865919 | |
11 | Acetylation | AIVAKLNKEDIIKDT HHHHHCCHHHHHHHH | 68.17 | 24489116 | |
16 | Acetylation | LNKEDIIKDTVKDLA CCHHHHHHHHHHHHH | 47.91 | 24489116 | |
56 | Phosphorylation | EATQAAPTIKFTPFD CCCCCCCCEEECCCC | 31.88 | 27017623 | |
58 | Acetylation | TQAAPTIKFTPFDKS CCCCCCEEECCCCHH | 45.74 | 24489116 | |
58 | Ubiquitination | TQAAPTIKFTPFDKS CCCCCCEEECCCCHH | 45.74 | 23749301 | |
64 | Acetylation | IKFTPFDKSQLSAED EEECCCCHHHCCHHH | 40.24 | 24489116 | |
64 | 2-Hydroxyisobutyrylation | IKFTPFDKSQLSAED EEECCCCHHHCCHHH | 40.24 | - | |
72 | Acetylation | SQLSAEDKLALLMTD HHCCHHHHHHHHHCC | 27.45 | 24489116 | |
130 | Acetylation | YIGPGPPKNSGYHRY CCCCCCCCCCCCEEE | 67.87 | 24489116 | |
143 | Ubiquitination | RYVFFLCKQPKGADS EEEEEEECCCCCCCC | 72.31 | 23749301 | |
146 | Ubiquitination | FFLCKQPKGADSSTF EEEECCCCCCCCCCC | 65.32 | 22817900 | |
187 | Phosphorylation | LQLVGANYYMVENTT EEEECCEEEEEECCE | 7.75 | 30377154 | |
188 | Phosphorylation | QLVGANYYMVENTTV EEECCEEEEEECCEE | 8.42 | 30377154 | |
199 | Phosphorylation | NTTVDFNYDM----- CCEEECCCCC----- | 17.24 | 30377154 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YL179_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YL179_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YL179_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SPC72_YEAST | SPC72 | physical | 16554755 | |
PIL1_YEAST | PIL1 | physical | 16554755 | |
MRP8_YEAST | MRP8 | physical | 16554755 | |
LSP1_YEAST | LSP1 | physical | 16554755 | |
DGK1_YEAST | DGK1 | genetic | 27708008 | |
ATG8_YEAST | ATG8 | genetic | 27708008 | |
NPL4_YEAST | NPL4 | genetic | 27708008 | |
SLX5_YEAST | SLX5 | genetic | 27708008 | |
GPR1_YEAST | GPR1 | genetic | 27708008 | |
VAM6_YEAST | VAM6 | genetic | 27708008 | |
MTC3_YEAST | MTC3 | genetic | 27708008 | |
PTH_YEAST | PTH1 | genetic | 27708008 | |
PIR5_YEAST | YJL160C | genetic | 27708008 | |
SET2_YEAST | SET2 | genetic | 27708008 | |
YJ24_YEAST | KCH1 | genetic | 27708008 | |
YRA2_YEAST | YRA2 | genetic | 27708008 | |
RL6B_YEAST | RPL6B | genetic | 27708008 | |
THI20_YEAST | THI20 | genetic | 27708008 | |
BUD21_YEAST | BUD21 | genetic | 27708008 | |
WHI5_YEAST | WHI5 | genetic | 27708008 | |
VPH1_YEAST | VPH1 | genetic | 27708008 | |
SRO7_YEAST | SRO7 | genetic | 27708008 | |
SYMC_YEAST | MES1 | genetic | 27453043 | |
DCOR_YEAST | SPE1 | genetic | 27453043 | |
DCAM_YEAST | SPE2 | genetic | 27453043 | |
SLX8_YEAST | SLX8 | genetic | 27453043 | |
YL422_YEAST | YLR422W | genetic | 27453043 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...