| UniProt ID | AUA1_YEAST | |
|---|---|---|
| UniProt AC | P32450 | |
| Protein Name | Ammonia regulation of amino acid uptake protein | |
| Gene Name | AUA1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 94 | |
| Subcellular Localization | ||
| Protein Description | Involved in ammonia regulation of the GAP1 permease.. | |
| Protein Sequence | MDRSLQVYICMYPYLDGSKQYRFDELISFYRPCPKSLDNIKSHYRQIHHQIRRRTHQHHQIRRRTHQHHHRSNCSRQRQCLVRHSCGRQMRVLA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AUA1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AUA1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AUA1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KPC1_YEAST | PKC1 | genetic | 27708008 | |
| CDK1_YEAST | CDC28 | genetic | 27708008 | |
| UBC3_YEAST | CDC34 | genetic | 27708008 | |
| UTP6_YEAST | UTP6 | genetic | 27708008 | |
| PSB3_YEAST | PUP3 | genetic | 27708008 | |
| SDA1_YEAST | SDA1 | genetic | 27708008 | |
| CDC12_YEAST | CDC12 | genetic | 27708008 | |
| DPOD2_YEAST | POL31 | genetic | 27708008 | |
| MCM1_YEAST | MCM1 | genetic | 27708008 | |
| DED1_YEAST | DED1 | genetic | 27708008 | |
| MED10_YEAST | NUT2 | genetic | 27708008 | |
| ATC3_YEAST | DRS2 | genetic | 27708008 | |
| YCZ2_YEAST | YCR102C | genetic | 27708008 | |
| MSN5_YEAST | MSN5 | genetic | 27708008 | |
| CEM1_YEAST | CEM1 | genetic | 27708008 | |
| CHD1_YEAST | CHD1 | genetic | 27708008 | |
| FRA1_YEAST | FRA1 | genetic | 27708008 | |
| YLL53_YEAST | YLL053C | genetic | 27708008 | |
| RSSA2_YEAST | RPS0B | genetic | 27708008 | |
| LIPB_YEAST | LIP2 | genetic | 27708008 | |
| TSR2_YEAST | TSR2 | genetic | 27708008 | |
| IZH2_YEAST | IZH2 | genetic | 27708008 | |
| TRM11_YEAST | TRM11 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...