UniProt ID | AUA1_YEAST | |
---|---|---|
UniProt AC | P32450 | |
Protein Name | Ammonia regulation of amino acid uptake protein | |
Gene Name | AUA1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 94 | |
Subcellular Localization | ||
Protein Description | Involved in ammonia regulation of the GAP1 permease.. | |
Protein Sequence | MDRSLQVYICMYPYLDGSKQYRFDELISFYRPCPKSLDNIKSHYRQIHHQIRRRTHQHHQIRRRTHQHHHRSNCSRQRQCLVRHSCGRQMRVLA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AUA1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AUA1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AUA1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KPC1_YEAST | PKC1 | genetic | 27708008 | |
CDK1_YEAST | CDC28 | genetic | 27708008 | |
UBC3_YEAST | CDC34 | genetic | 27708008 | |
UTP6_YEAST | UTP6 | genetic | 27708008 | |
PSB3_YEAST | PUP3 | genetic | 27708008 | |
SDA1_YEAST | SDA1 | genetic | 27708008 | |
CDC12_YEAST | CDC12 | genetic | 27708008 | |
DPOD2_YEAST | POL31 | genetic | 27708008 | |
MCM1_YEAST | MCM1 | genetic | 27708008 | |
DED1_YEAST | DED1 | genetic | 27708008 | |
MED10_YEAST | NUT2 | genetic | 27708008 | |
ATC3_YEAST | DRS2 | genetic | 27708008 | |
YCZ2_YEAST | YCR102C | genetic | 27708008 | |
MSN5_YEAST | MSN5 | genetic | 27708008 | |
CEM1_YEAST | CEM1 | genetic | 27708008 | |
CHD1_YEAST | CHD1 | genetic | 27708008 | |
FRA1_YEAST | FRA1 | genetic | 27708008 | |
YLL53_YEAST | YLL053C | genetic | 27708008 | |
RSSA2_YEAST | RPS0B | genetic | 27708008 | |
LIPB_YEAST | LIP2 | genetic | 27708008 | |
TSR2_YEAST | TSR2 | genetic | 27708008 | |
IZH2_YEAST | IZH2 | genetic | 27708008 | |
TRM11_YEAST | TRM11 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...