dbPTM

YL415_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YL415_YEAST
UniProt AC	O13578
Protein Name	Putative uncharacterized protein YLR415C, mitochondrial
Gene Name	YLR415C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	112
Subcellular Localization	Mitochondrion .
Protein Description
Protein Sequence	MYLSAQLMRTVTASHLTLRALSTPPLFQHRQIAAVEWCGTTRPGLARQKRTQHASSVISKSGVLSAKPSSVFLALLAGKLAEKYIYARMLLFHVSVVNECPVVFHSGPVVWK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
2	Phosphorylation	------MYLSAQLMR ------CCCHHHHHH	14.90	28132839

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YL415_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YL415_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YL415_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MDL2_YEAST	MDL2	genetic	27708008
CHK1_YEAST	CHK1	genetic	27708008
RIM1_YEAST	RIM1	genetic	27708008
THRC_YEAST	THR4	genetic	27708008
SLX5_YEAST	SLX5	genetic	27708008
GPR1_YEAST	GPR1	genetic	27708008
RXT3_YEAST	RXT3	genetic	27708008
YD180_YEAST	YDL180W	genetic	27708008
ATIF_YEAST	INH1	genetic	27708008
RL41A_YEAST	RPL41A	genetic	27708008
RL41B_YEAST	RPL41A	genetic	27708008
RAD4_YEAST	RAD4	genetic	27708008
MSH4_YEAST	MSH4	genetic	27708008
QCR9_YEAST	QCR9	genetic	27708008
SNF6_YEAST	SNF6	genetic	27708008
FLX1_YEAST	FLX1	genetic	27708008
ATG32_YEAST	ATG32	genetic	27708008
BNR1_YEAST	BNR1	genetic	27708008
ASF1_YEAST	ASF1	genetic	27708008
PIR5_YEAST	YJL160C	genetic	27708008
CSN12_YEAST	YJR084W	genetic	27708008
IME1_YEAST	IME1	genetic	27708008
HAP4_YEAST	HAP4	genetic	27708008
SAC1_YEAST	SAC1	genetic	27708008
XDJ1_YEAST	XDJ1	genetic	27708008
RL37A_YEAST	RPL37A	genetic	27708008
COQ2_YEAST	COQ2	genetic	27708008
LAG2_YEAST	LAG2	genetic	27708008
MSN1_YEAST	MSN1	genetic	27708008
HIR2_YEAST	HIR2	genetic	27708008
COQ7_YEAST	CAT5	genetic	27708008
MNE1_YEAST	MNE1	genetic	27708008
TBP6_YEAST	YTA6	genetic	27708008
NEW1_YEAST	NEW1	genetic	27708008
VPS4_YEAST	VPS4	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YL415_YEAST

Related Literatures of Post-Translational Modification