dbPTM

YBR3_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YBR3_YEAST
UniProt AC	P38083
Protein Name	Uncharacterized protein YBR063C
Gene Name	YBR063C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	404
Subcellular Localization	Membrane Multi-pass membrane protein .
Protein Description
Protein Sequence	MEELGLKSTFPYEYGSDFTMIRTEMLNTTKSETTILFSNIKSILAIIWKYSFTFLRSFSDSIKLIIDDVVTIGSRNFAERLQIEAKKNNDQEDIWASTIILGVIIGYLISSIKRKNTFPIMPTSSPKIDDCRFKTGDTISIVINFNEDCLNNRSDVTEERNYEESTVLHSKESVLSIGRQNMVTLNQSDENFTYGNFDEYDLLTKDYTTEVLTRSPGSNPEFKAVVNNTLLDSANETPFKGIEKSINETMVKVPMGCDVSLSHYGRQYAPGNISIMRSFTARDNTKSVSREIRDICKSFLIIKSQFGDELFLTMFMEKPVFFDNNIPIEITGAYREKRERLDEVIHKDLIRYDEVQNLTRIRNLLRVKSQKICSRRHNSSVPTKKLLVNDKGATSILLWYSNYS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
117	Phosphorylation	SSIKRKNTFPIMPTS HHHHCCCCCCCCCCC	33.55	20377248
374	Phosphorylation	VKSQKICSRRHNSSV HHHHHHHHCCCCCCC	35.50	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YBR3_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YBR3_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YBR3_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BDF2_YEAST	BDF2	genetic	27708008
ARO1_YEAST	ARO1	genetic	27708008
MPC3_YEAST	MPC3	genetic	27708008
KSP1_YEAST	KSP1	genetic	27708008
F26_YEAST	FBP26	genetic	27708008
HIR3_YEAST	HIR3	genetic	27708008
BRE2_YEAST	BRE2	genetic	27708008
PSP2_YEAST	PSP2	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YBR3_YEAST

Related Literatures of Post-Translational Modification