dbPTM

PFA5_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PFA5_YEAST
UniProt AC	Q03289
Protein Name	Palmitoyltransferase PFA5
Gene Name	PFA5
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	374
Subcellular Localization	Membrane Multi-pass membrane protein.
Protein Description
Protein Sequence	MALSWNIRIRRRSWFRFILPIIVLGLLCYGTWAYCHKLCYEQVDKRLRQKSVSVGLICAVCFLDVVVIFIWLQIVILVGPGTQPHVAPFLILPIASEEKTSNTSQNTSVEYDAVVPPKCYQSDPHGYPIWCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFVQFAAYFSTLLLIMWVSICVYIRIITQHNHNYSPNLNANIISTLVFAILGWLLTASLLASSIFYMSQNKTSLEAIIDSKRKKFGTRKIFCYYSEANKLRFVVEFDRSEFHSFWDKKSILANIKDFMGSNILMWIIPLGKPYTSRCKSDGKSGSKTTLVEILGPYEETLSDYTIQAIEDKISRGEYLATLRASGDDSDPAY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
158	Phosphorylation	CIPRFDHYCMWIGTV CCCCCCCEEEHHHHE	5.95	28889911
355	Phosphorylation	QAIEDKISRGEYLAT HHHHHHCCCCCHHHH	39.72	19779198

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PFA5_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PFA5_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PFA5_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YGK8_YEAST	YGL108C	physical	19416974
GPI1_YEAST	GPI1	physical	16093310
SLX5_YEAST	SLX5	genetic	27708008
AGP1_YEAST	AGP1	genetic	27708008
ODO2_YEAST	KGD2	genetic	27708008
SAC3_YEAST	SAC3	genetic	27708008
RAD4_YEAST	RAD4	genetic	27708008
CHO2_YEAST	CHO2	genetic	27708008
YHK5_YEAST	YHR045W	genetic	27708008
CSN12_YEAST	YJR084W	genetic	27708008
ELM1_YEAST	ELM1	genetic	27708008
PRY2_YEAST	PRY2	genetic	27708008
OCA2_YEAST	OCA2	genetic	27708008
SUCA_YEAST	LSC1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PFA5_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-158, AND MASSSPECTROMETRY.	18407956 [Abstract]