| UniProt ID | ADY1_YEAST | |
|---|---|---|
| UniProt AC | P38872 | |
| Protein Name | Prospore formation at selected spindle poles protein 1 | |
| Gene Name | PFS1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 237 | |
| Subcellular Localization | Nucleus . Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body . Nuclear in mononucleate meiotic cells. May not be localized to the spindle pole body or prospore membrane. | |
| Protein Description | Involved in the pathway that organizes the shaping and sizing of the prospore membrane (PSM) during sporulation. Required to localize MPC54 to all four spindle pole bodies, and localize DON1 and SPO14 to four prospore membranes.. | |
| Protein Sequence | MNQGYTQLSAPELKETKTSKLNKMNNFRSSPIAEIINKIPPDCGKIQNTTFPEFNPALRRRQHEQWPAYEKPIRVTDSMSPQLSSINCLPNLYPHGTLPLPNPYLSYLNHIEKVNCQDVKFSNWSVLHNSNNGFEIPTYFSPRTTQNMPCSEKVESWLERLPIFVGFDGYLFTNCFDYEYMLDWEETEFTFEKTSCMETDYSKALTDTDIIYIQEKKIEALIRNQYLKEYEFSQKDF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ADY1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ADY1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ADY1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
