| UniProt ID | HPA2_YEAST | |
|---|---|---|
| UniProt AC | Q06592 | |
| Protein Name | Histone acetyltransferase HPA2 {ECO:0000303|PubMed:10600387} | |
| Gene Name | HPA2 {ECO:0000303|PubMed:10600387} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 156 | |
| Subcellular Localization | ||
| Protein Description | N-acetyltransferase that acetylates histone H3 at 'Lys-14' and histone H4 at 'Lys-5' and 'Lys-12'. Also acetylates polyamines like putrescine, spermidine and spermine, and certain other small basic proteins like nuclear HMG proteins.. | |
| Protein Sequence | MSNTSEDNITVRFVTENDKEGWQRLWKSYQDFYEVSFPDDLDDFNFGRFLDPNIKMWAAVAVESSSEKIIGMINFFNHMTTWDFKDKIYINDLYVDENSRVKGAGGKLIQFVYDEADKLGTPSVYWCTDESNHRAQLLYVKVGYKAPKILYKRKGY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of HPA2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HPA2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HPA2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HPA2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
