dbPTM

MIX14_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MIX14_YEAST
UniProt AC	Q04341
Protein Name	Mitochondrial intermembrane space cysteine motif-containing protein MIX14
Gene Name	MIX14
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	121
Subcellular Localization	Mitochondrion intermembrane space . Imported into mitochondrion intermembrane space through the MIA pathway.
Protein Description
Protein Sequence	MSDILDEIVIEDVVANCPQEFLQYHKCIRDNEENPGKCKDGRMILSTCIREKVPSVKSIMSECSEPMKKYDQCIRDNMGTRTINENCLGFLQDLRKCAELQVKNKNIKPSINGVNLELIKD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of MIX14_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MIX14_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MIX14_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MIX14_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
MRM2_YEAST	MRM2	genetic	27708008
ASK10_YEAST	ASK10	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MIX14_YEAST

Related Literatures of Post-Translational Modification