| UniProt ID | NHP6B_YEAST | |
|---|---|---|
| UniProt AC | P11633 | |
| Protein Name | Non-histone chromosomal protein 6B | |
| Gene Name | NHP6B | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 99 | |
| Subcellular Localization | Nucleus . Chromosome . | |
| Protein Description | DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. Also augments the fidelity of transcription by RNA polymerase III independently of any role in the FACT complex. Required for transcriptional initiation fidelity of some but not all tRNA genes. Seems to be functionally redundant with NHP6A.. | |
| Protein Sequence | MAATKEAKQPKEPKKRTTRRKKDPNAPKRGLSAYMFFANENRDIVRSENPDVTFGQVGRILGERWKALTAEEKQPYESKAQADKKRYESEKELYNATRA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Acetylation | MAATKEAKQPKEPKK CCCCHHHCCCCCCCC | 69.12 | 25381059 | |
| 22 | Acetylation | KRTTRRKKDPNAPKR CCCCCCCCCCCCCCC | 76.29 | 25381059 | |
| 32 | Phosphorylation | NAPKRGLSAYMFFAN CCCCCCHHHHHHCCC | 21.85 | 30377154 | |
| 47 | Phosphorylation | ENRDIVRSENPDVTF CCCHHHHCCCCCCCH | 30.72 | 28889911 | |
| 53 | Phosphorylation | RSENPDVTFGQVGRI HCCCCCCCHHHHHHH | 29.45 | 22369663 | |
| 91 | Acetylation | KKRYESEKELYNATR HHHHHHHHHHHHHHC | 63.40 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NHP6B_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NHP6B_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NHP6B_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
