| UniProt ID | RNP1_YEAST | |
|---|---|---|
| UniProt AC | P32385 | |
| Protein Name | Ribonucleoprotein 1 | |
| Gene Name | RNP1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 249 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MLIEEIEFYNVNGKKTTTVVPENTKIKKRVLNDRRTLYVGNLPKNCRKQDLRDLFEPNYGKITINMLKKKPLKKPLKRFAFIEFQEGVNLKKVKEKMNGKIFMNEKIVIENILTKEEKSFEKNQKSNKKTAPDLKPLSTNTLYVKNIPMKSTNEDLAKIFGVDPKNINFVRRELVDLRTNKVFFSDEFHTGEAFIKFDNLGTGDSIQKKCREFKGRKASNGRVLLVKIASAKKNEQKQEGGDNTKIKQN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Phosphorylation | LIEEIEFYNVNGKKT CEEEEEEEEECCCEE | 12.86 | 28132839 | |
| 36 | Phosphorylation | RVLNDRRTLYVGNLP EHHCCCCEEEECCCC | 24.28 | 28889911 | |
| 151 | Phosphorylation | VKNIPMKSTNEDLAK EECCCCCCCCHHHHH | 30.16 | 27017623 | |
| 202 | Phosphorylation | IKFDNLGTGDSIQKK EEECCCCCCHHHHHH | 40.77 | 21126336 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RNP1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RNP1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RNP1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RIC1_YEAST | RIC1 | genetic | 19061648 | |
| SWD3_YEAST | SWD3 | genetic | 19061648 | |
| EFTU_YEAST | TUF1 | genetic | 19061648 | |
| SYDM_YEAST | MSD1 | genetic | 19061648 | |
| SLT11_YEAST | ECM2 | genetic | 19061648 | |
| SIF2_YEAST | SIF2 | genetic | 19061648 | |
| NUP53_YEAST | NUP53 | genetic | 19061648 | |
| RIM1_YEAST | RIM1 | genetic | 20093466 | |
| YD514_YEAST | YDR514C | genetic | 20093466 | |
| AK_YEAST | HOM3 | genetic | 20093466 | |
| ATC1_YEAST | PMR1 | genetic | 20093466 | |
| RRM3_YEAST | RRM3 | genetic | 20093466 | |
| YIT6_YEAST | YIR016W | genetic | 20093466 | |
| MSC1_YEAST | MSC1 | genetic | 20093466 | |
| INO4_YEAST | INO4 | genetic | 20093466 | |
| SRS2_YEAST | SRS2 | genetic | 21459050 | |
| INO4_YEAST | INO4 | genetic | 27708008 | |
| ODO2_YEAST | KGD2 | genetic | 27708008 | |
| VPS24_YEAST | VPS24 | genetic | 27708008 | |
| MSC1_YEAST | MSC1 | genetic | 27708008 | |
| IMP2_YEAST | IMP2 | genetic | 27708008 | |
| MSC6_YEAST | MSC6 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...