| UniProt ID | PUN1_YEAST | |
|---|---|---|
| UniProt AC | Q06991 | |
| Protein Name | Protein PUN1 | |
| Gene Name | PUN1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 263 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein . Localizes to punctate patches in the plasma membrane that show extensive colocalization with SUR7. |
|
| Protein Description | Contributes to the wild-type cellular response to nitrogen stress through signaling pathways that regulate the expression of genes involved in amino acid biosynthesis. Required for wild-type filamentous growth, cell growth, and cell-cell adhesion.. | |
| Protein Sequence | MRNFFTLFFAAIFSLGALILAIVACAGSTKNYSPINKIYCAELDLSQMKVSTVLPSLSSATLSSLGLPSYINIGLWSYCTVDSSHNIQSCSSPHGIQNFNLSSLVYDNINNNEALELMDSVASVVLPEKLKSKMTYYNNLVKCMFITILIGIVLTFVNLVFNVLRWIIHIRPLTWFGAFFSFFAFAALLVSIGSCLGTYSYIKYILKHNYSDYGISMSIGRNYQGLMWGAVVGALLNFILWCSVRSRPTVIYANAPIEEKPLI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 100 | N-linked_Glycosylation | PHGIQNFNLSSLVYD CCCCCCCCHHHHEEE | 46.71 | - | |
| 209 | N-linked_Glycosylation | IKYILKHNYSDYGIS HHHHHHCCCCCCCEE | 36.09 | - | |
| 260 | Ubiquitination | ANAPIEEKPLI---- ECCCCCCCCCC---- | 32.13 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PUN1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PUN1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PUN1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PUN1_YEAST | PUN1 | physical | 21223946 | |
| MRM2_YEAST | MRM2 | genetic | 27708008 | |
| RTG2_YEAST | RTG2 | genetic | 27708008 | |
| VPS8_YEAST | VPS8 | genetic | 27708008 | |
| CSG2_YEAST | CSG2 | genetic | 27708008 | |
| PANB_YEAST | ECM31 | genetic | 27708008 | |
| HSP78_YEAST | HSP78 | genetic | 27708008 | |
| DAL81_YEAST | DAL81 | genetic | 27708008 | |
| VPS53_YEAST | VPS53 | genetic | 27708008 | |
| SRN2_YEAST | SRN2 | genetic | 27708008 | |
| BUL2_YEAST | BUL2 | genetic | 27708008 | |
| PET8_YEAST | PET8 | genetic | 27708008 | |
| VHS3_YEAST | VHS3 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Ubiquitylation | |
| Reference | PubMed |
| "A subset of membrane-associated proteins is ubiquitinated in responseto mutations in the endoplasmic reticulum degradation machinery."; Hitchcock A.L., Auld K., Gygi S.P., Silver P.A.; Proc. Natl. Acad. Sci. U.S.A. 100:12735-12740(2003). Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-260, AND MASSSPECTROMETRY. | |
