PANB_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PANB_YEAST
• UniProt AC: P38122
• Protein Name: 3-methyl-2-oxobutanoate hydroxymethyltransferase
• Gene Name: ECM31
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 312
• Protein Sequence: MNIMKRQLCTSSKRFFSTAKNVVKYNTIQDIRNKYFTGTPLSMCTAYDFITATWVNKANCDLLLVGDSLAMTSLGYDSTITLSLNEFKYHVASVCRAEGSSMVVVDMPFGTFESGISDGLKNAIDIMKLDSKVTSVKVEVGSYTKDKYAMKFIEELCSRGIPVMAHIGLTPQKVHSLGGYKVQGSKSLLQMQELYETAMQLQKIGCWSILIECVPHKMAQFITSKLSVPTIGIGAGNGTSGQVLVISDLLGMQGDSVPKFVKQAVNMTDIATQGLKEYIASVEDRTFPERGTHTFKVKEDLWNEFLSSINEK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
292	Phosphorylation	RTFPERGTHTFKVKE CCCCCCCCCEEEEEH	24.78	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PANB_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PANB_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PANB_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PANB_YEAST	ECM31	physical	10688190
PANB_YEAST	ECM31	physical	18719252
FEN2_YEAST	FEN2	genetic	17284612
ELO3_YEAST	ELO3	genetic	21623372
PDX3_YEAST	PDX3	genetic	21623372
THRC_YEAST	THR4	genetic	21623372
RPB1_YEAST	RPO21	genetic	27708008
FAL1_YEAST	FAL1	genetic	27708008
SRPR_YEAST	SRP101	genetic	27708008
RNA1_YEAST	RNA1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.