| UniProt ID | NDJ1_YEAST | |
|---|---|---|
| UniProt AC | Q12366 | |
| Protein Name | Non-disjunction protein 1 | |
| Gene Name | NDJ1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 352 | |
| Subcellular Localization | Nucleus . Chromosome, telomere . | |
| Protein Description | Required for telomeric clustering (bouquet stage) during meiosis 1 prophase, formation and efficient homolog pairing, meiosis 1 disjunction, and telomere deletion during meiosis. Promotes also meiotic recombination.. | |
| Protein Sequence | MSKDNRLASILLQPVASSSGNCTEFHDSKLHTLQEELNFLPLEGVASNVCPPMFRGHKNYVFVLYCLNQVDLVTNLQDSTKRYYPLQIFKDCQLSSLVQKDFSHYFQLSRQKEGEDRNDSDTTLVNVVNSGVSRHRSQLLKMCIIPRICSFDKSNSKTYKLIQEYVNRFETVLTKFGPEKDFTKVYANWSKLIESFNELILHDLLVKWQQWSELTQPNATVHQNIPNVLRELVIKLTQRYFTFQPSYSCSIDEFTTILLNKNALSLLDVFRKPRKYKLNFGLWLDCQNGILIFTNGIVQMADEITSERVKSFVRPAHLLVLEDHSNDEAVKKLMFFTFSAILQCFTDEILNC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 17 | Phosphorylation | ILLQPVASSSGNCTE HHHHCCCCCCCCCCC | 25.85 | 27214570 | |
| 18 | Phosphorylation | LLQPVASSSGNCTEF HHHCCCCCCCCCCCC | 32.31 | 27214570 | |
| 74 | Phosphorylation | LNQVDLVTNLQDSTK CCCCCHHHCCCCCCC | 37.19 | 28889911 | |
| 120 | Phosphorylation | EGEDRNDSDTTLVNV CCCCCCCCCCCHHHH | 40.17 | 27214570 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDJ1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDJ1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDJ1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PCH2_YEAST | PCH2 | genetic | 17174924 | |
| RAD17_YEAST | RAD17 | genetic | 17174924 | |
| CSM4_YEAST | CSM4 | physical | 18818742 | |
| RAD4_YEAST | RAD4 | genetic | 20093466 | |
| YOR1_YEAST | YOR1 | genetic | 20093466 | |
| RS27B_YEAST | RPS27B | genetic | 20093466 | |
| LST4_YEAST | LST4 | genetic | 20093466 | |
| YMD8_YEAST | YMD8 | genetic | 20093466 | |
| MEK1_YEAST | MEK1 | genetic | 20888230 | |
| CND2_YEAST | BRN1 | genetic | 27708008 | |
| RPN12_YEAST | RPN12 | genetic | 27708008 | |
| CLP1_YEAST | CLP1 | genetic | 27708008 | |
| PSB6_YEAST | PRE7 | genetic | 27708008 | |
| PRP6_YEAST | PRP6 | genetic | 27708008 | |
| TEL2_YEAST | TEL2 | genetic | 27708008 | |
| MED6_YEAST | MED6 | genetic | 27708008 | |
| RIF1_YEAST | RIF1 | physical | 28455351 | |
| ESC8_YEAST | ESC8 | physical | 28455351 | |
| NOP56_YEAST | NOP56 | physical | 28455351 | |
| NUP2_YEAST | NUP2 | physical | 28455351 | |
| NUP2_YEAST | NUP2 | genetic | 28455351 | |
| SPO11_YEAST | SPO11 | genetic | 28455351 | |
| MPS3_YEAST | MPS3 | physical | 25897084 | |
| SPC72_YEAST | SPC72 | physical | 25897084 | |
| RAP1_YEAST | RAP1 | physical | 25897084 | |
| SPO11_YEAST | SPO11 | genetic | 25897084 | |
| MPS3_YEAST | MPS3 | genetic | 25897084 | |
| PO152_YEAST | POM152 | genetic | 25897084 | |
| NDJ1_YEAST | NDJ1 | physical | 25897084 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-74, AND MASSSPECTROMETRY. | |