| UniProt ID | ERV41_YEAST | |
|---|---|---|
| UniProt AC | Q04651 | |
| Protein Name | ER-derived vesicles protein ERV41 | |
| Gene Name | ERV41 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 352 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. Golgi apparatus membrane Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane Multi-pass membrane protein. Recycles between endoplasmic reticulum and |
|
| Protein Description | Constituent of COPII-coated endoplasmic reticulum-derived transport vesicles. Required for efficient transport of a subset of secretory proteins to the Golgi. The C-terminal Ile-Leu motif is required for exit from the endoplasmic reticulum. Facilitates retrograde transport from the Golgi to the endoplasmic reticulum.. | |
| Protein Sequence | MAGLKTFDAFPKTEEQYKKKSTKGGLTSLLTYLFLLFIAWTEFGEYFGGYIDQQYVVDSQVRDTVQINMDIYVNTKCDWLQINVRDQTMDRKLVLEELQLEEMPFFIPYDTKVNDINEIITPELDEILGEAIPAEFREKLDTRSFFDESDPNKAHLPEFNGCHVFGSIPVNRVSGELQITAKSLGYVASRKAPLEELKFNHVINEFSFGDFYPYIDNPLDNTAQFNQDEPLTTYVYYTSVVPTLFKKLGAEVDTNQYSVNDYRYLYKDVAAKGDKMPGIFFKYNFEPLSIVVSDVRLSFIQFLVRLVAICSFLVYCASWIFTLLDMALITIMGPKWSLRYQPDDKTKGILDR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Ubiquitination | ---MAGLKTFDAFPK ---CCCCCCCCCCCC | 46.35 | 24961812 | |
| 12 | Ubiquitination | KTFDAFPKTEEQYKK CCCCCCCCCHHHHHC | 63.21 | 23749301 | |
| 12 | Acetylation | KTFDAFPKTEEQYKK CCCCCCCCCHHHHHC | 63.21 | 24489116 | |
| 88 | Phosphorylation | QINVRDQTMDRKLVL EEECCCCCCCHHHHH | 25.90 | 24930733 | |
| 191 | Ubiquitination | LGYVASRKAPLEELK HCCEECCCCCHHHHC | 52.43 | 23749301 | |
| 247 | Ubiquitination | VVPTLFKKLGAEVDT HHHHHHHHHCCCCCC | 44.83 | 23749301 | |
| 347 | Ubiquitination | YQPDDKTKGILDR-- ECCCCCCCCCCCC-- | 50.09 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ERV41_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ERV41_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ERV41_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
