dbPTM

CUE4_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CUE4_YEAST
UniProt AC	Q04201
Protein Name	CUE domain-containing protein CUE4
Gene Name	CUE4
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	117
Subcellular Localization	Cytoplasm . Endoplasmic reticulum .
Protein Description
Protein Sequence	MDGSTIVFILTMVCLFVYTVKHRGAKQVPSRTVQDAKPAPSVATNDPSPEPVPSAPEERVARLNRHGSDRKRAVNSDMVEIVMTMAPHVPQEKVVQDLRNTGSIEHTMENIFAGKLD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
32	Phosphorylation	AKQVPSRTVQDAKPA CCCCCCCCCCCCCCC	27.19	22369663
37	Ubiquitination	SRTVQDAKPAPSVAT CCCCCCCCCCCCCCC	50.42	23749301
41	Phosphorylation	QDAKPAPSVATNDPS CCCCCCCCCCCCCCC	26.87	22369663
44	Phosphorylation	KPAPSVATNDPSPEP CCCCCCCCCCCCCCC	37.69	22369663
48	Phosphorylation	SVATNDPSPEPVPSA CCCCCCCCCCCCCCC	44.77	22369663
54	Phosphorylation	PSPEPVPSAPEERVA CCCCCCCCCCHHHHH	57.60	22369663
68	Phosphorylation	ARLNRHGSDRKRAVN HHHHHCCCHHHHHCC	28.28	21551504

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CUE4_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CUE4_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CUE4_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBC2_YEAST	RAD6	physical	16554755
YNS1_YEAST	YNL181W	genetic	16269340
ILM1_YEAST	ILM1	genetic	16269340
SPC2_YEAST	SPC2	genetic	16269340
GET3_YEAST	GET3	physical	11283351
VPS25_YEAST	VPS25	physical	11283351
GET3_YEAST	GET3	physical	18719252
CTK1_YEAST	CTK1	genetic	27708008
PAU8_YEAST	PAU8	genetic	27708008
PAU11_YEAST	PAU8	genetic	27708008
PAU9_YEAST	PAU8	genetic	27708008
SLA1_YEAST	SLA1	genetic	27708008
ATG8_YEAST	ATG8	genetic	27708008
TXTP_YEAST	CTP1	genetic	27708008
GPR1_YEAST	GPR1	genetic	27708008
ATG9_YEAST	ATG9	genetic	27708008
YD180_YEAST	YDL180W	genetic	27708008
NBP2_YEAST	NBP2	genetic	27708008
RLA4_YEAST	RPP2B	genetic	27708008
CEM1_YEAST	CEM1	genetic	27708008
MRM2_YEAST	MRM2	genetic	27708008
ATG1_YEAST	ATG1	genetic	27708008
MUP1_YEAST	MUP1	genetic	27708008
SMI1_YEAST	SMI1	genetic	27708008
KEL2_YEAST	KEL2	genetic	27708008
WSS1_YEAST	WSS1	genetic	27708008
VPS53_YEAST	VPS53	genetic	27708008
LPLA_YEAST	AIM22	genetic	27708008
RPA34_YEAST	RPA34	genetic	27708008
DHOM_YEAST	HOM6	genetic	27708008
PRY2_YEAST	PRY2	genetic	27708008
BCH2_YEAST	BCH2	genetic	27708008
RT109_YEAST	RTT109	genetic	27708008
ALAM_YEAST	ALT1	genetic	27708008
LIPB_YEAST	LIP2	genetic	27708008
RL31B_YEAST	RPL31B	genetic	27708008
YL413_YEAST	INA1	genetic	27708008
ZRC1_YEAST	ZRC1	genetic	27708008
ATG3_YEAST	ATG3	genetic	27708008
TLG2_YEAST	TLG2	genetic	27708008
NOP12_YEAST	NOP12	genetic	27708008
SFL1_YEAST	SFL1	genetic	27708008
SUCA_YEAST	LSC1	genetic	27708008
LIPA_YEAST	LIP5	genetic	27708008
PMA2_YEAST	PMA2	genetic	27708008
YP039_YEAST	YPL039W	genetic	27708008
UBQL1_HUMAN	UBQLN1	physical	27107014
SGTA_HUMAN	SGTA	physical	27107014

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CUE4_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-48 AND SER-54, AND MASSSPECTROMETRY.	18407956 [Abstract]
"Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-48, AND MASSSPECTROMETRY.	17563356 [Abstract]