UniProt ID | TXTP_YEAST | |
---|---|---|
UniProt AC | P38152 | |
Protein Name | Tricarboxylate transport protein | |
Gene Name | CTP1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 299 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein. |
|
Protein Description | Transport of citrate across inner mitochondrial membrane.. | |
Protein Sequence | MSSKATKSDVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKTAKTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRDSETGELSGTRGVIAGLGAGLLESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQSLDSTKYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYEKVLVMLA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
62 | Ubiquitination | VLIYKTAKTQGIGSI EEEEEECCCCCCCEE | 46.76 | 17644757 | |
63 | Phosphorylation | LIYKTAKTQGIGSIY EEEEECCCCCCCEEE | 29.57 | 19779198 | |
83 | Ubiquitination | FIIGNTAKAGIRFLG EEECCHHHHCCEEEC | 45.14 | 17644757 | |
134 | Ubiquitination | VTPFEAIKTALIDDK CCHHHHHHHHHCCCC | 34.49 | 17644757 | |
135 | Phosphorylation | TPFEAIKTALIDDKQ CHHHHHHHHHCCCCC | 22.15 | 29688323 | |
141 | Ubiquitination | KTALIDDKQSATPKY HHHHCCCCCCCCCCC | 42.26 | 17644757 | |
143 | Phosphorylation | ALIDDKQSATPKYHN HHCCCCCCCCCCCCC | 39.59 | 29688323 | |
145 | Phosphorylation | IDDKQSATPKYHNNG CCCCCCCCCCCCCCC | 26.09 | 29688323 | |
147 | Ubiquitination | DKQSATPKYHNNGRG CCCCCCCCCCCCCCC | 55.58 | 17644757 | |
198 | Phosphorylation | GCYNKIKTLIQDYTD CCHHHHHHHHHHCCC | 32.35 | 21126336 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TXTP_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TXTP_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TXTP_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...