UniProt ID | PAU9_YEAST | |
---|---|---|
UniProt AC | Q3E770 | |
Protein Name | Seripauperin-9 | |
Gene Name | PAU9 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 120 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MVKLTSIAAGVAAIAATASATTTLAQSDERVNLVELGVYVSDIRAHLAQYYMFQAAHPTETYPVEVAEAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSSRLKPAISSALSKDGIYTIAN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of PAU9_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAU9_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAU9_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAU9_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBC3_YEAST | CDC34 | genetic | 27708008 | |
RPB7_YEAST | RPB7 | genetic | 27708008 | |
ARP3_YEAST | ARP3 | genetic | 27708008 | |
RNA1_YEAST | RNA1 | genetic | 27708008 | |
NOP2_YEAST | NOP2 | genetic | 27708008 | |
TYSY_YEAST | CDC21 | genetic | 27708008 | |
DED1_YEAST | DED1 | genetic | 27708008 | |
DYR_YEAST | DFR1 | genetic | 27708008 | |
RPB1_YEAST | RPO21 | genetic | 27708008 | |
TFB1_YEAST | TFB1 | genetic | 27708008 | |
SMT3_YEAST | SMT3 | genetic | 27708008 | |
RSP5_YEAST | RSP5 | genetic | 27708008 | |
HSF_YEAST | HSF1 | genetic | 27708008 | |
MET30_YEAST | MET30 | genetic | 27708008 | |
CDC6_YEAST | CDC6 | genetic | 27708008 | |
PRP21_YEAST | PRP21 | genetic | 27708008 | |
FNTA_YEAST | RAM2 | genetic | 27708008 | |
MED14_YEAST | RGR1 | genetic | 27708008 | |
GSP1_YEAST | GSP1 | genetic | 27708008 | |
CDC25_YEAST | CDC25 | genetic | 27708008 | |
ERO1_YEAST | ERO1 | genetic | 27708008 | |
CH10_YEAST | HSP10 | genetic | 27708008 | |
MED4_YEAST | MED4 | genetic | 27708008 | |
MOT1_YEAST | MOT1 | genetic | 27708008 | |
TBF1_YEAST | TBF1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...