| UniProt ID | CH10_YEAST | |
|---|---|---|
| UniProt AC | P38910 | |
| Protein Name | 10 kDa heat shock protein, mitochondrial | |
| Gene Name | HSP10 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 106 | |
| Subcellular Localization | Mitochondrion matrix. | |
| Protein Description | Eukaryotic CPN10 homolog which is essential for mitochondrial protein biogenesis, together with CPN60. Binds to CPN60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter.. | |
| Protein Sequence | MSTLLKSAKSIVPLMDRVLVQRIKAQAKTASGLYLPEKNVEKLNQAEVVAVGPGFTDANGNKVVPQVKVGDQVLIPQFGGSTIKLGNDDEVILFRDAEILAKIAKD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSTLLKSAK ------CCHHHHHHH | 27.97 | 22814378 | |
| 2 | Phosphorylation | ------MSTLLKSAK ------CCHHHHHHH | 27.97 | 30377154 | |
| 3 | Phosphorylation | -----MSTLLKSAKS -----CCHHHHHHHH | 34.51 | 30377154 | |
| 6 | Succinylation | --MSTLLKSAKSIVP --CCHHHHHHHHHHH | 52.02 | 23954790 | |
| 6 | 2-Hydroxyisobutyrylation | --MSTLLKSAKSIVP --CCHHHHHHHHHHH | 52.02 | - | |
| 6 | Acetylation | --MSTLLKSAKSIVP --CCHHHHHHHHHHH | 52.02 | 22865919 | |
| 7 | Phosphorylation | -MSTLLKSAKSIVPL -CCHHHHHHHHHHHH | 40.68 | 30377154 | |
| 9 | Succinylation | STLLKSAKSIVPLMD CHHHHHHHHHHHHHH | 48.05 | 23954790 | |
| 9 | Acetylation | STLLKSAKSIVPLMD CHHHHHHHHHHHHHH | 48.05 | 24489116 | |
| 10 | Phosphorylation | TLLKSAKSIVPLMDR HHHHHHHHHHHHHHH | 28.65 | 28152593 | |
| 29 | Phosphorylation | RIKAQAKTASGLYLP HHHHHCHHCCCCCCC | 29.13 | 22369663 | |
| 31 | Phosphorylation | KAQAKTASGLYLPEK HHHCHHCCCCCCCHH | 34.26 | 22369663 | |
| 34 | Phosphorylation | AKTASGLYLPEKNVE CHHCCCCCCCHHHHH | 24.60 | 21440633 | |
| 38 | Acetylation | SGLYLPEKNVEKLNQ CCCCCCHHHHHHHCC | 65.44 | 24489116 | |
| 38 | Ubiquitination | SGLYLPEKNVEKLNQ CCCCCCHHHHHHHCC | 65.44 | 22817900 | |
| 38 | 2-Hydroxyisobutyrylation | SGLYLPEKNVEKLNQ CCCCCCHHHHHHHCC | 65.44 | - | |
| 38 | Succinylation | SGLYLPEKNVEKLNQ CCCCCCHHHHHHHCC | 65.44 | 23954790 | |
| 42 | Ubiquitination | LPEKNVEKLNQAEVV CCHHHHHHHCCCCEE | 48.75 | 22817900 | |
| 42 | Acetylation | LPEKNVEKLNQAEVV CCHHHHHHHCCCCEE | 48.75 | 24489116 | |
| 62 | Acetylation | FTDANGNKVVPQVKV EECCCCCEEECCEEE | 46.11 | 24489116 | |
| 68 | Acetylation | NKVVPQVKVGDQVLI CEEECCEEECCEEEE | 34.94 | 24489116 | |
| 81 | Phosphorylation | LIPQFGGSTIKLGND EEEECCCCEEECCCC | 27.60 | 25521595 | |
| 82 | Phosphorylation | IPQFGGSTIKLGNDD EEECCCCEEECCCCC | 25.96 | 21440633 | |
| 102 | Acetylation | RDAEILAKIAKD--- ECHHHHHHHHCC--- | 39.49 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CH10_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CH10_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CH10_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-31, AND MASSSPECTROMETRY. | |
