dbPTM

COX5B_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	COX5B_YEAST
UniProt AC	P00425
Protein Name	Cytochrome c oxidase polypeptide 5B, mitochondrial
Gene Name	COX5B
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	151
Subcellular Localization	Mitochondrion inner membrane.
Protein Description
Protein Sequence	MLRTSLTKGARLTGTRFVQTKALSKATLTDLPERWENMPNLEQKEIADNLTERQKLPWKTLNNEEIKAAWYISYGEWGPRRPVHGKGDVAFITKGVFLGLGISFGLFGLVRLLANPETPKTMNREWQLKSDEYLKSKNANPWGGYSQVQSK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
133	Phosphorylation	WQLKSDEYLKSKNAN CCCCCHHHHHCCCCC	25.15	28132839

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of COX5B_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of COX5B_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of COX5B_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
COX5A_YEAST	COX5A	genetic	21623372
CSG2_YEAST	CSG2	genetic	21623372
COX9_YEAST	COX9	genetic	21623372
THDH_YEAST	ILV1	genetic	21623372
ATPA_YEAST	ATP1	genetic	21623372
GSH1_YEAST	GSH1	genetic	21623372
KCS1_YEAST	KCS1	genetic	21623372
PDX3_YEAST	PDX3	genetic	21623372
CY1_YEAST	CYT1	genetic	21623372
QCR2_YEAST	QCR2	genetic	21623372
PFKA1_YEAST	PFK1	genetic	21623372
THRC_YEAST	THR4	genetic	21623372
IDH2_YEAST	IDH2	genetic	21623372
RL19A_YEAST	RPL19B	genetic	27708008
RL19B_YEAST	RPL19B	genetic	27708008
NU170_YEAST	NUP170	genetic	27708008
GDT1_YEAST	GDT1	genetic	27708008
MET8_YEAST	MET8	genetic	27708008
SLX5_YEAST	SLX5	genetic	27708008
CYK3_YEAST	CYK3	genetic	27708008
AIR2_YEAST	AIR2	genetic	27708008
ARX1_YEAST	ARX1	genetic	27708008
VBA4_YEAST	VBA4	genetic	27708008
SAC3_YEAST	SAC3	genetic	27708008
MSN5_YEAST	MSN5	genetic	27708008
RLA4_YEAST	RPP2B	genetic	27708008
RV167_YEAST	RVS167	genetic	27708008
MED20_YEAST	SRB2	genetic	27708008
SHH3_YEAST	SHH3	genetic	27708008
COX5A_YEAST	COX5A	genetic	27708008
PFD4_YEAST	GIM3	genetic	27708008
GYP1_YEAST	GYP1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of COX5B_YEAST

Related Literatures of Post-Translational Modification