dbPTM

SHH3_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SHH3_YEAST
UniProt AC	Q04487
Protein Name	Mitochondrial inner membrane protein SHH3 {ECO:0000305}
Gene Name	SHH3 {ECO:0000303\|PubMed:22152483}
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	196
Subcellular Localization	Mitochondrion inner membrane Multi-pass membrane protein .
Protein Description	Homolog of SDH3, but seems not to be a stoichiometric subunit of either the succinate dehydrogenase (SDH) complex or the mitochondrial inner membrane translocase TIM22 complex..
Protein Sequence	MKATIQRVTSVFGVPRASVFVPRISTPFILHNYISNGRMDLFSKEFHNGRVSKSDLWSSNKEEELLVSQRKKRPISPHLTVYEPEMSWYLSSLHRISGVLLALGFYAFTITLGVTTIMGMDTTFQDLNKWYHEKMPKWSQWVAKGSAAYLFAFHFGNGIRHLIWDMGYELTNRGVIKTGSIVLAGTLVLGTYLLAQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SHH3_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SHH3_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SHH3_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SHH3_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SDH3_YEAST	SDH3	genetic	18408719
ODC1_YEAST	ODC1	physical	16093310
RL23A_YEAST	RPL23A	genetic	27708008
RL23B_YEAST	RPL23A	genetic	27708008
GPR1_YEAST	GPR1	genetic	27708008
MNN10_YEAST	MNN10	genetic	27708008
AST2_YEAST	AST2	genetic	27708008
RL11B_YEAST	RPL11B	genetic	27708008
DBF2_YEAST	DBF2	genetic	27708008
BUB1_YEAST	BUB1	genetic	27708008
ELP2_YEAST	ELP2	genetic	27708008
SLT2_YEAST	SLT2	genetic	27708008
PIH1_YEAST	PIH1	genetic	27708008
VPS35_YEAST	VPS35	genetic	27708008
DPOD3_YEAST	POL32	genetic	27708008
BYE1_YEAST	BYE1	genetic	27708008
KTI12_YEAST	KTI12	genetic	27708008
YRA2_YEAST	YRA2	genetic	27708008
MMM1_YEAST	MMM1	genetic	27708008
PHO84_YEAST	PHO84	genetic	27708008
GAS1_YEAST	GAS1	genetic	27708008
VPS17_YEAST	VPS17	genetic	27708008
MED1_YEAST	MED1	genetic	27708008
PHSG_YEAST	GPH1	genetic	27708008
COQ6_YEAST	COQ6	genetic	27453043
VPS1_YEAST	VPS1	genetic	27453043
SNF5_YEAST	SNF5	genetic	27453043
BUB1_YEAST	BUB1	genetic	27453043
TBB_YEAST	TUB2	genetic	27453043
ADE_YEAST	AAH1	genetic	27453043
PPA3_YEAST	PHO3	genetic	27453043

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SHH3_YEAST

Related Literatures of Post-Translational Modification