dbPTM

SRL3_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SRL3_YEAST
UniProt AC	P36167
Protein Name	Protein SRL3
Gene Name	SRL3
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	246
Subcellular Localization	Cytoplasm .
Protein Description	Weakly suppresses a RAD53 null mutation when overexpressed..
Protein Sequence	MFLKTPNWETVNETPKSRVLTINELISPNLDTESNSLLATPARKYFKTSISEAQDSPTSAPSPDGNEDPTYQYNVQFHFPGPITPTTPRSKNAEMFPSPTPPLVSPTAVIEEENDDSVREFSRTLKSRLNCAMVKLSKEHEQVALIPPPPTEKIRKGSYSNKFAAKHRRCHSLDESKKFLSSLEDSSAHAAFLKAISSKHAKSNRVDNVNVSPLRWSSHRRTQSTQENSLQEVVAIDTLLKMSSSD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MFLKTPNWETVN ---CCCCCCCCCCCC	24.81	23749301
10	Phosphorylation	LKTPNWETVNETPKS CCCCCCCCCCCCCCC	21.90	24961812
14	Phosphorylation	NWETVNETPKSRVLT CCCCCCCCCCCCEEE	30.71	28152593
16	Ubiquitination	ETVNETPKSRVLTIN CCCCCCCCCCEEEHH	59.31	23749301
17	Phosphorylation	TVNETPKSRVLTINE CCCCCCCCCEEEHHH	28.91	21082442
27	Phosphorylation	LTINELISPNLDTES EEHHHHCCCCCCCCC	21.99	21440633
32	Phosphorylation	LISPNLDTESNSLLA HCCCCCCCCCCCCCC	44.47	21440633
34	Phosphorylation	SPNLDTESNSLLATP CCCCCCCCCCCCCCC	33.54	23749301
36	Phosphorylation	NLDTESNSLLATPAR CCCCCCCCCCCCCHH	33.76	23749301
40	Phosphorylation	ESNSLLATPARKYFK CCCCCCCCCHHHHHC	19.90	21440633
56	Phosphorylation	SISEAQDSPTSAPSP CHHHHCCCCCCCCCC	20.28	21440633
62	Phosphorylation	DSPTSAPSPDGNEDP CCCCCCCCCCCCCCC	35.03	23749301
98	Phosphorylation	KNAEMFPSPTPPLVS CCCCCCCCCCCCCCC	30.09	22369663
100	Phosphorylation	AEMFPSPTPPLVSPT CCCCCCCCCCCCCCC	41.71	22369663
105	Phosphorylation	SPTPPLVSPTAVIEE CCCCCCCCCCEEEEE	24.98	22369663
107	Phosphorylation	TPPLVSPTAVIEEEN CCCCCCCCEEEEECC	26.50	28132839
117	Phosphorylation	IEEENDDSVREFSRT EEECCCHHHHHHHHH	26.41	22369663
122	Phosphorylation	DDSVREFSRTLKSRL CHHHHHHHHHHHHHH	21.43	22369663
127	Phosphorylation	EFSRTLKSRLNCAMV HHHHHHHHHHCCEEE	45.15	28889911
160	Phosphorylation	KIRKGSYSNKFAAKH HHCCCCCCCHHHHHH	34.93	21440633
172	Phosphorylation	AKHRRCHSLDESKKF HHHHHCCCHHHHHHH	40.93	22369663
176	Phosphorylation	RCHSLDESKKFLSSL HCCCHHHHHHHHHHC	40.59	28132839
181	Phosphorylation	DESKKFLSSLEDSSA HHHHHHHHHCCHHHH	35.69	30377154
182	Phosphorylation	ESKKFLSSLEDSSAH HHHHHHHHCCHHHHH	37.61	27017623
186	Phosphorylation	FLSSLEDSSAHAAFL HHHHCCHHHHHHHHH	21.76	27017623
187	Phosphorylation	LSSLEDSSAHAAFLK HHHCCHHHHHHHHHH	36.07	27017623
203	Phosphorylation	ISSKHAKSNRVDNVN HHHHHHHHCCCCCCC	30.56	24961812
212	Phosphorylation	RVDNVNVSPLRWSSH CCCCCCCCCCCCCCC	17.02	22369663
217	Phosphorylation	NVSPLRWSSHRRTQS CCCCCCCCCCCCCCC	15.16	24961812
218	Phosphorylation	VSPLRWSSHRRTQST CCCCCCCCCCCCCCC	17.66	24961812
222	Phosphorylation	RWSSHRRTQSTQENS CCCCCCCCCCCCCCC	27.16	22369663
224	Phosphorylation	SSHRRTQSTQENSLQ CCCCCCCCCCCCCHH	31.29	22369663
225	Phosphorylation	SHRRTQSTQENSLQE CCCCCCCCCCCCHHH	30.04	22369663
229	Phosphorylation	TQSTQENSLQEVVAI CCCCCCCCHHHHHHH	30.58	22369663

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SRL3_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SRL3_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SRL3_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CG12_YEAST	CLN2	physical	25619768
GRR1_YEAST	GRR1	physical	28839131

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SRL3_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-212, AND MASSSPECTROMETRY.	18407956 [Abstract]