| UniProt ID | RNH2C_YEAST | |
|---|---|---|
| UniProt AC | Q12338 | |
| Protein Name | Ribonuclease H2 subunit C | |
| Gene Name | RNH203 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 110 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Non catalytic subunit of RNase H2, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes.. | |
| Protein Sequence | MTKDAVNLDAYTVSFMPFYTEYQGPTEEFKDYKFEDTIYFRGKELKREKSATPSSSDNTTSNTFSNGAILSGNTITGKIVSVNNYEREGTDRNELARLQELISLIDVINQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 50 | Phosphorylation | KELKREKSATPSSSD EECCCCCCCCCCCCC | 32.40 | 23749301 | |
| 56 | Phosphorylation | KSATPSSSDNTTSNT CCCCCCCCCCCCCCC | 38.94 | 23749301 | |
| 59 | Phosphorylation | TPSSSDNTTSNTFSN CCCCCCCCCCCCCCC | 36.27 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RNH2C_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RNH2C_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RNH2C_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
