| UniProt ID | SMT3_YEAST | |
|---|---|---|
| UniProt AC | Q12306 | |
| Protein Name | Ubiquitin-like protein SMT3 | |
| Gene Name | SMT3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 101 | |
| Subcellular Localization | ||
| Protein Description | Not known; suppressor of MIF2 mutations.. | |
| Protein Sequence | MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGATY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSDSEVNQE ------CCHHHHCHH | 50.25 | 17287358 | |
| 2 | Phosphorylation | ------MSDSEVNQE ------CCHHHHCHH | 50.25 | 22369663 | |
| 4 | Phosphorylation | ----MSDSEVNQEAK ----CCHHHHCHHCC | 35.82 | 22369663 | |
| 11 | Sumoylation | SEVNQEAKPEVKPEV HHHCHHCCCCCCCCC | 40.74 | - | |
| 15 | Sumoylation | QEAKPEVKPEVKPET HHCCCCCCCCCCCCC | 33.52 | - | |
| 19 | Sumoylation | PEVKPEVKPETHINL CCCCCCCCCCCEEEE | 35.16 | - | |
| 27 | Ubiquitination | PETHINLKVSDGSSE CCCEEEEEECCCCCE | 34.89 | 17644757 | |
| 29 | Phosphorylation | THINLKVSDGSSEIF CEEEEEECCCCCEEE | 34.37 | 28889911 | |
| 32 | Phosphorylation | NLKVSDGSSEIFFKI EEEECCCCCEEEEEE | 29.77 | 22369663 | |
| 33 | Phosphorylation | LKVSDGSSEIFFKIK EEECCCCCEEEEEEE | 40.00 | 22369663 | |
| 38 | Acetylation | GSSEIFFKIKKTTPL CCCEEEEEEECCCHH | 42.75 | 24489116 | |
| 38 | Ubiquitination | GSSEIFFKIKKTTPL CCCEEEEEEECCCHH | 42.75 | 17644757 | |
| 54 | Acetylation | RLMEAFAKRQGKEMD HHHHHHHHHCCCCCH | 38.51 | 24489116 | |
| 54 | Ubiquitination | RLMEAFAKRQGKEMD HHHHHHHHHCCCCCH | 38.51 | 23749301 | |
| 58 | Acetylation | AFAKRQGKEMDSLRF HHHHHCCCCCHHHHH | 41.34 | 24489116 | |
| 58 | Ubiquitination | AFAKRQGKEMDSLRF HHHHHCCCCCHHHHH | 41.34 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SMT3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SMT3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SMT3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-32 AND SER-33, AND MASSSPECTROMETRY. | |
| "Analysis of phosphorylation sites on proteins from Saccharomycescerevisiae by electron transfer dissociation (ETD) massspectrometry."; Chi A., Huttenhower C., Geer L.Y., Coon J.J., Syka J.E.P., Bai D.L.,Shabanowitz J., Burke D.J., Troyanskaya O.G., Hunt D.F.; Proc. Natl. Acad. Sci. U.S.A. 104:2193-2198(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2 AND SER-4, AND MASSSPECTROMETRY. | |
| "Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2, AND MASSSPECTROMETRY. | |
