| UniProt ID | NSE2_YEAST | |
|---|---|---|
| UniProt AC | P38632 | |
| Protein Name | E3 SUMO-protein ligase MMS21 | |
| Gene Name | MMS21 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 267 | |
| Subcellular Localization | Nucleus . Cytoplasm . | |
| Protein Description | Acts as an E3 ligase mediating SUMO/Smt3 attachment to SMC5 and YKU70. Acts in a DNA repair pathway for removal of UV-induced DNA damage that is distinct from classical nucleotide excision repair and in repair of ionizing radiation damage. Functions in homologous recombination repair of DNA double strand breaks and in recovery of stalled replication forks.. | |
| Protein Sequence | MALNDNPIPKSVPLHPKSGKYFHNLHARDLSNIYQQCYKQIDETINQLVDSTSPSTIGIEEQVADITSTYKLLSTYESESNSFDEHIKDLKKNFKQSSDACPQIDLSTWDKYRTGELTAPKLSELYLNMPTPEPATMVNNTDTLKILKVLPYIWNDPTCVIPDLQNPADEDDLQIEGGKIELTCPITCKPYEAPLISRKCNHVFDRDGIQNYLQGYTTRDCPQAACSQVVSMRDFVRDPIMELRCKIAKMKESQEQDKRSSQAIDVL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 20 | Acetylation | PLHPKSGKYFHNLHA CCCCCCCCCCCCCCH | 52.40 | 25381059 | |
| 112 | Phosphorylation | DLSTWDKYRTGELTA CHHHHHCHHCCCCCC | 15.78 | 19823750 | |
| 114 | Phosphorylation | STWDKYRTGELTAPK HHHHCHHCCCCCCCC | 31.73 | 19823750 | |
| 118 | Phosphorylation | KYRTGELTAPKLSEL CHHCCCCCCCCHHHH | 36.29 | 19823750 | |
| 126 | Phosphorylation | APKLSELYLNMPTPE CCCHHHHHHCCCCCC | 7.62 | 27017623 | |
| 260 | Phosphorylation | SQEQDKRSSQAIDVL HHHHHHHHHHHHHCC | 32.32 | 22369663 | |
| 261 | Phosphorylation | QEQDKRSSQAIDVL- HHHHHHHHHHHHCC- | 27.88 | 21440633 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NSE2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NSE2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NSE2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
