UniProt ID | YFK5_YEAST | |
---|---|---|
UniProt AC | P43608 | |
Protein Name | Uncharacterized protein YFR035C | |
Gene Name | YFR035C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 114 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MSASDKTKLCNKGMSRTSRTTTFVITPAFRERDDEGANSLCKAFLNTFSNLKSGMFKCLLGVGAVGTFISTFPQFFLLPCLLCVRCVCVCLCASISYAASAIFSFSIFFFFCLA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YFK5_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YFK5_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YFK5_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YFK5_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PAA1_YEAST | PAA1 | genetic | 27708008 | |
SWD1_YEAST | SWD1 | genetic | 27708008 | |
THRC_YEAST | THR4 | genetic | 27708008 | |
NHP10_YEAST | NHP10 | genetic | 27708008 | |
GPR1_YEAST | GPR1 | genetic | 27708008 | |
WHI4_YEAST | WHI4 | genetic | 27708008 | |
SAC3_YEAST | SAC3 | genetic | 27708008 | |
RAV2_YEAST | RAV2 | genetic | 27708008 | |
UME6_YEAST | UME6 | genetic | 27708008 | |
YD286_YEAST | YDR286C | genetic | 27708008 | |
INM2_YEAST | INM2 | genetic | 27708008 | |
PEX29_YEAST | PEX29 | genetic | 27708008 | |
IRC4_YEAST | IRC4 | genetic | 27708008 | |
IES5_YEAST | IES5 | genetic | 27708008 | |
AIM11_YEAST | AIM11 | genetic | 27708008 | |
RS21B_YEAST | RPS21B | genetic | 27708008 | |
SET2_YEAST | SET2 | genetic | 27708008 | |
RL14A_YEAST | RPL14A | genetic | 27708008 | |
DBR1_YEAST | DBR1 | genetic | 27708008 | |
ERG3_YEAST | ERG3 | genetic | 27708008 | |
ICT1_YEAST | ICT1 | genetic | 27708008 | |
YL287_YEAST | YLR287C | genetic | 27708008 | |
SST2_YEAST | SST2 | genetic | 27708008 | |
CTK3_YEAST | CTK3 | genetic | 27708008 | |
GTR1_YEAST | GTR1 | genetic | 27708008 | |
MSC1_YEAST | MSC1 | genetic | 27708008 | |
SOK2_YEAST | SOK2 | genetic | 27708008 | |
NST1_YEAST | NST1 | genetic | 27708008 | |
YME1_YEAST | YME1 | genetic | 27708008 | |
NAA30_YEAST | MAK3 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...