dbPTM

YD286_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YD286_YEAST
UniProt AC	Q05530
Protein Name	Glutaredoxin-like protein YDR286C
Gene Name	YDR286C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	114
Subcellular Localization
Protein Description
Protein Sequence	MLRAFRCSIHTSRVLLHDAGVKLTFFSKPNCGLCDQAKEVIDDVFERKEFHNKAVSLEIVNITDRRNAKWWKEYCFDIPVLHIEKVGDPKSCTKILHFLEEDDISDKIRRMQSR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of YD286_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YD286_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YD286_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YD286_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SCC1_YEAST	MCD1	genetic	27708008
NAB3_YEAST	NAB3	genetic	27708008
MED10_YEAST	NUT2	genetic	27708008
CDC24_YEAST	CDC24	genetic	27708008
RPB1_YEAST	RPO21	genetic	27708008
MOB2_YEAST	MOB2	genetic	27708008
CDC14_YEAST	CDC14	genetic	27708008
SEC65_YEAST	SEC65	genetic	27708008
ERO1_YEAST	ERO1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YD286_YEAST

Related Literatures of Post-Translational Modification