FMP33_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FMP33_YEAST
• UniProt AC: P46998
• Protein Name: Mitochondrial membrane protein FMP33
• Gene Name: FMP33
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 180
• Subcellular Localization: Mitochondrion membrane ; Multi-pass membrane protein .
• Protein Sequence: MLYTRLLRHNSQFTKFSGTSPNLGSKPLFSKGNLYTSLLVTTLYGTGLACLYLESNSLNKSKEQEDPHAIAEDDIVNIVHDAPNRIFKPALDTYQEKELDLQKSDLHKVLHSLTYSDVSQFSIVWGFLIQLSSLIGNSTLGKKSILYKGSVVSVLGFPPLIYMALKLRMKQLEKAGVRFE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of FMP33_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FMP33_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FMP33_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FMP33_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SRS2_YEAST	SRS2	genetic	21459050
MOB1_YEAST	MOB1	genetic	27708008
DPOD_YEAST	POL3	genetic	27708008
SCC4_YEAST	SCC4	genetic	27708008
MET30_YEAST	MET30	genetic	27708008
PRS7_YEAST	RPT1	genetic	27708008
TAD3_YEAST	TAD3	genetic	27708008
RNA1_YEAST	RNA1	genetic	27708008
SYA_YEAST	ALA1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.