UniProt ID | FMP33_YEAST | |
---|---|---|
UniProt AC | P46998 | |
Protein Name | Mitochondrial membrane protein FMP33 | |
Gene Name | FMP33 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 180 | |
Subcellular Localization |
Mitochondrion membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MLYTRLLRHNSQFTKFSGTSPNLGSKPLFSKGNLYTSLLVTTLYGTGLACLYLESNSLNKSKEQEDPHAIAEDDIVNIVHDAPNRIFKPALDTYQEKELDLQKSDLHKVLHSLTYSDVSQFSIVWGFLIQLSSLIGNSTLGKKSILYKGSVVSVLGFPPLIYMALKLRMKQLEKAGVRFE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of FMP33_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FMP33_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FMP33_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FMP33_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SRS2_YEAST | SRS2 | genetic | 21459050 | |
MOB1_YEAST | MOB1 | genetic | 27708008 | |
DPOD_YEAST | POL3 | genetic | 27708008 | |
SCC4_YEAST | SCC4 | genetic | 27708008 | |
MET30_YEAST | MET30 | genetic | 27708008 | |
PRS7_YEAST | RPT1 | genetic | 27708008 | |
TAD3_YEAST | TAD3 | genetic | 27708008 | |
RNA1_YEAST | RNA1 | genetic | 27708008 | |
SYA_YEAST | ALA1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...