UniProt ID | YGB0_YEAST | |
---|---|---|
UniProt AC | P25338 | |
Protein Name | Uncharacterized endoplasmic reticulum membrane protein YGL010W | |
Gene Name | YGL010W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 174 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | Not an essential protein for cell growth.. | |
Protein Sequence | MGEGLLDLRSQLGFYKFYHHNPKNVLIHSIFVPTILFSGSCMLHRVKIYQSISLTAVLSVLFSIFYCLLYLPTGLLAGVLLLLLNLALIDHRVDLTFKQELGLFTIGWIFQFVGHGVFEKRRPALIDNLVQSLVLAPYFIMFEFLFKLGFMPRLKATLEHDLEIKQRNLRMQRQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YGB0_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YGB0_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YGB0_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YGB0_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ORM1_YEAST | ORM1 | genetic | 16269340 | |
SCS3_YEAST | SCS3 | genetic | 16269340 | |
EPT1_YEAST | EPT1 | genetic | 16269340 | |
ASI3_YEAST | ASI3 | genetic | 16269340 | |
ERG1_YEAST | ERG1 | genetic | 16269340 | |
OSTB_YEAST | WBP1 | genetic | 16269340 | |
BFR1_YEAST | BFR1 | genetic | 16269340 | |
SLX5_YEAST | SLX5 | genetic | 27708008 | |
FIT1_YEAST | FIT1 | genetic | 27708008 | |
ARP1_YEAST | ARP1 | genetic | 27708008 | |
YIF4_YEAST | YIL054W | genetic | 27708008 | |
LPLA_YEAST | AIM22 | genetic | 27708008 | |
DHOM_YEAST | HOM6 | genetic | 27708008 | |
DIA2_YEAST | DIA2 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...