| UniProt ID | YGD9_YEAST | |
|---|---|---|
| UniProt AC | P53183 | |
| Protein Name | Putative uncharacterized oxidoreductase YGL039W | |
| Gene Name | YGL039W | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 348 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MTTEKTVVFVSGATGFIALHVVDDLLKTGYKVIGSGRSQEKNDGLLKKFKSNPNLSMEIVEDIAAPNAFDKVFQKHGKEIKVVLHIASPVHFNTTDFEKDLLIPAVNGTKSILEAIKNYAADTVEKVVITSSVAALASPGDMKDTSFVVNEESWNKDTWESCQANAVSAYCGSKKFAEKTAWDFLEENQSSIKFTLSTINPGFVFGPQLFADSLRNGINSSSAIIANLVSYKLGDNFYNYSGPFIDVRDVSKAHLLAFEKPECAGQRLFLCEDMFCSQEALDILNEEFPQLKGKIATGEPGSGSTFLTKNCCKCDNRKTKNLLGFQFNKFRDCIVDTASQLLEVQSKS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 51 | Phosphorylation | GLLKKFKSNPNLSME CHHHHHHCCCCCCEE | 61.73 | 21440633 | |
| 130 | Phosphorylation | TVEKVVITSSVAALA CCEEEEEEEHHHHHC | 11.88 | 19795423 | |
| 131 | Phosphorylation | VEKVVITSSVAALAS CEEEEEEEHHHHHCC | 16.22 | 19795423 | |
| 132 | Phosphorylation | EKVVITSSVAALASP EEEEEEEHHHHHCCC | 13.71 | 19795423 | |
| 138 | Phosphorylation | SSVAALASPGDMKDT EHHHHHCCCCCCCCC | 30.20 | 19795423 | |
| 309 | Ubiquitination | SGSTFLTKNCCKCDN CCCEEECCCCCCCCC | 50.57 | 23749301 | |
| 329 | Acetylation | LLGFQFNKFRDCIVD CCCHHCCHHHHHHHH | 42.96 | 24489116 | |
| 339 | Phosphorylation | DCIVDTASQLLEVQS HHHHHHHHHHHHHHC | 24.37 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YGD9_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YGD9_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YGD9_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| VHR2_YEAST | VHR2 | physical | 16554755 | |
| MTU1_YEAST | SLM3 | physical | 16429126 | |
| APC11_YEAST | APC11 | genetic | 27708008 | |
| CDC1_YEAST | CDC1 | genetic | 27708008 | |
| RFC2_YEAST | RFC2 | genetic | 27708008 | |
| TAD3_YEAST | TAD3 | genetic | 27708008 | |
| DCP2_YEAST | DCP2 | genetic | 27708008 | |
| SEC63_YEAST | SEC63 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
