YA065_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YA065_YEAST
• UniProt AC: O13511
• Protein Name: Uncharacterized protein YAL065C
• Gene Name: YAL065C
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 128
• Subcellular Localization: Membrane ; Single-pass membrane protein .
• Protein Sequence: MNSATSETTTNTGAAETTTSTGAAETKTVVTSSISRFNHAETQTASATDVIGHSSSVVSVSETGNTKSLITSGLSTMSQQPRSTPASSIIGSSTASLEISTYVGIANGLLTNNGISVFISTVLLAIVW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
20	Phosphorylation	GAAETTTSTGAAETK CCCEEECCCCCEECE	23.81	28132839
21	Phosphorylation	AAETTTSTGAAETKT CCEEECCCCCEECEE	28.84	28132839
26	Phosphorylation	TSTGAAETKTVVTSS CCCCCEECEEEEECC	27.56	28132839

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YA065_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YA065_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YA065_YEAST !!

Protein-Protein Interaction

Oops, there are no PPI records of YA065_YEAST !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.