| UniProt ID | IES4_YEAST | |
|---|---|---|
| UniProt AC | Q08561 | |
| Protein Name | Ino eighty subunit 4 | |
| Gene Name | IES4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 116 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | ||
| Protein Sequence | MSQESSVLSESQEQLANNPKIEDTSPPSANSRDNSKPVLPWDYKNKAIEIKSFSGYKVNFTGWIRRDVREERQRGSEFTASDVKGSDDKATRKKEPADEDPEVKQLEKEGEDGLDS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSQESSVLS ------CCHHHHHHC | 42.53 | 22369663 | |
| 5 | Phosphorylation | ---MSQESSVLSESQ ---CCHHHHHHCHHH | 20.36 | 22369663 | |
| 6 | Phosphorylation | --MSQESSVLSESQE --CCHHHHHHCHHHH | 26.73 | 22369663 | |
| 9 | Phosphorylation | SQESSVLSESQEQLA CHHHHHHCHHHHHHH | 32.80 | 22369663 | |
| 11 | Phosphorylation | ESSVLSESQEQLANN HHHHHCHHHHHHHHC | 35.32 | 22369663 | |
| 24 | Phosphorylation | NNPKIEDTSPPSANS HCCCCCCCCCCCCCC | 30.28 | 24909858 | |
| 25 | Phosphorylation | NPKIEDTSPPSANSR CCCCCCCCCCCCCCC | 47.32 | 21082442 | |
| 28 | Phosphorylation | IEDTSPPSANSRDNS CCCCCCCCCCCCCCC | 43.39 | 20377248 | |
| 31 | Phosphorylation | TSPPSANSRDNSKPV CCCCCCCCCCCCCCC | 40.50 | 29136822 | |
| 36 | Acetylation | ANSRDNSKPVLPWDY CCCCCCCCCCCCCCC | 45.45 | 24489116 | |
| 43 | Phosphorylation | KPVLPWDYKNKAIEI CCCCCCCCCCCEEEE | 16.76 | 21551504 | |
| 81 | Phosphorylation | RGSEFTASDVKGSDD HCCCCCHHHCCCCCC | 39.62 | 27017623 | |
| 108 | Ubiquitination | PEVKQLEKEGEDGLD HHHHHHHHHCCCCCC | 78.57 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IES4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IES4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IES4_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-9; SER-11 AND SER-25,AND MASS SPECTROMETRY. | |
