| UniProt ID | MVB12_YEAST | |
|---|---|---|
| UniProt AC | P42939 | |
| Protein Name | Multivesicular body sorting factor 12 | |
| Gene Name | MVB12 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 101 | |
| Subcellular Localization |
Cytoplasm . Endosome . Late endosome membrane Peripheral membrane protein . |
|
| Protein Description | Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Appears to be involved in cargo sorting and release of the ESCRT-I complex from the MVBs.. | |
| Protein Sequence | MNNNVEELLRRIPLYNKYGKDFPQETVTRFQMPEFKLPALQPTRDLLCPWYEECDNITKVCQLHDSSNKKFDQWYKEQYLSKKPPGIVGNTLLSPSRKDNS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MNNNVEEL -------CCCCHHHH | 12.51 | 22814378 | |
| 91 | Phosphorylation | PPGIVGNTLLSPSRK CCCCCCCCCCCCCCC | 24.13 | 21440633 | |
| 94 | Phosphorylation | IVGNTLLSPSRKDNS CCCCCCCCCCCCCCC | 24.76 | 19823750 | |
| 96 | Phosphorylation | GNTLLSPSRKDNS-- CCCCCCCCCCCCC-- | 48.89 | 21440633 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MVB12_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MVB12_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Analysis of phosphorylation sites on proteins from Saccharomycescerevisiae by electron transfer dissociation (ETD) massspectrometry."; Chi A., Huttenhower C., Geer L.Y., Coon J.J., Syka J.E.P., Bai D.L.,Shabanowitz J., Burke D.J., Troyanskaya O.G., Hunt D.F.; Proc. Natl. Acad. Sci. U.S.A. 104:2193-2198(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-94, AND MASSSPECTROMETRY. | |