| UniProt ID | IMPX_YEAST | |
|---|---|---|
| UniProt AC | P32351 | |
| Protein Name | Sugar utilization regulatory protein IMP2 | |
| Gene Name | IMP2' | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 346 | |
| Subcellular Localization | ||
| Protein Description | Controls the nucleo-mitochondrial dependence of galactose, maltose and raffinose utilization. Becomes essential in the absence of functioning mitochondria.. | |
| Protein Sequence | MQKSILLTKPDGTQSNLHSIKTETPTTVEFDSEQMERGHRERGRSKKKRGERDSNVSSLSRSRSRASSRSRVREEEFLKWTVLRQDPSMRLRVVDVDSEEEGEGNDEDDDDGDGDDMDEEESDEEQVSDIENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIRGHENEDVSLEQLDGGYVRAMQLLTKGAGAEAGNQRSFILYTDLSSESTYALTYLMGAAVNQGDTVYIVHWEPSKPTDDSQMFANVARIRKHVMHLFDCVAGVLDDLDVVVLSLTHPYPKHLLNEMIHGLKPVALCCSLSVILSTLQNFVCSVPILAVRKKLKRAKRKGISE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MQKSILLTKPD ----CCCEEEEECCC | 11.11 | 21440633 | |
| 9 | Acetylation | QKSILLTKPDGTQSN CCEEEEECCCCCCCC | 40.87 | 24489116 | |
| 22 | Phosphorylation | SNLHSIKTETPTTVE CCCCCCEECCCCEEE | 43.34 | 28132839 | |
| 24 | Phosphorylation | LHSIKTETPTTVEFD CCCCEECCCCEEECC | 31.03 | 17330950 | |
| 26 | Phosphorylation | SIKTETPTTVEFDSE CCEECCCCEEECCHH | 51.39 | 27017623 | |
| 32 | Phosphorylation | PTTVEFDSEQMERGH CCEEECCHHHHHHHH | 34.74 | 27214570 | |
| 54 | Phosphorylation | KKRGERDSNVSSLSR CCCCCCCCCHHHHHH | 45.40 | 28889911 | |
| 57 | Phosphorylation | GERDSNVSSLSRSRS CCCCCCHHHHHHHHH | 29.79 | 22369663 | |
| 58 | Phosphorylation | ERDSNVSSLSRSRSR CCCCCHHHHHHHHHH | 26.53 | 22369663 | |
| 60 | Phosphorylation | DSNVSSLSRSRSRAS CCCHHHHHHHHHHHH | 30.11 | 22369663 | |
| 62 | Phosphorylation | NVSSLSRSRSRASSR CHHHHHHHHHHHHHH | 31.09 | 24930733 | |
| 200 | Ubiquitination | RAMQLLTKGAGAEAG HHHHHHHCCCCCCCC | 46.89 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IMPX_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IMPX_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IMPX_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ATN1_YEAST | ENA1 | genetic | 9611200 | |
| SIS2_YEAST | SIS2 | genetic | 9611200 | |
| GAL4_YEAST | GAL4 | genetic | 14558142 | |
| MIG1_YEAST | MIG1 | genetic | 14558142 | |
| NRG1_YEAST | NRG1 | genetic | 14558142 | |
| DED1_YEAST | DED1 | physical | 22940862 | |
| YG51_YEAST | YGR237C | physical | 22940862 | |
| IMPX_YEAST | IMP2 | physical | 22940862 | |
| PP12_YEAST | GLC7 | physical | 22940862 | |
| JIP4_YEAST | JIP4 | physical | 22940862 | |
| TPO1_YEAST | TPO1 | genetic | 24599794 | |
| TPO2_YEAST | TPO2 | genetic | 24599794 | |
| AP1_YEAST | YAP1 | genetic | 24599794 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-24, AND MASSSPECTROMETRY. | |
