| UniProt ID | NOP15_YEAST | |
|---|---|---|
| UniProt AC | P53927 | |
| Protein Name | Ribosome biogenesis protein 15 | |
| Gene Name | NOP15 {ECO:0000303|PubMed:11583614} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 220 | |
| Subcellular Localization | Cytoplasm . Nucleus, nucleolus . | |
| Protein Description | Involved in the biogenesis of the 60S ribosomal subunit. Required for pre-rRNA processing and cytokinesis. Associates with the precursors of the 25S and 5.8S rRNAs.. | |
| Protein Sequence | MVKSTSKTSTKETVTKQPTEEKPIQEKEELALETSSSSSDEEDEKDEDEIEGLAASDDEQSGTHKIKRLNPKKQANEKKSKDKKTLEEYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQESMNNYLLMGHLLQVRVLPKGAKIEKLYKYKKRVLVEKGITKPVKQLKDNMKQKHEERIKKLAKSGIEFKW | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 11 | Acetylation | STSKTSTKETVTKQP CCCCCCCCCCCCCCC | 51.67 | 25381059 | |
| 16 | Acetylation | STKETVTKQPTEEKP CCCCCCCCCCCCCCC | 50.36 | 22865919 | |
| 34 | Phosphorylation | KEELALETSSSSSDE HHHHHHHCCCCCCCC | 34.46 | 19823750 | |
| 35 | Phosphorylation | EELALETSSSSSDEE HHHHHHCCCCCCCCC | 20.88 | 19795423 | |
| 36 | Phosphorylation | ELALETSSSSSDEED HHHHHCCCCCCCCCC | 41.48 | 19795423 | |
| 37 | Phosphorylation | LALETSSSSSDEEDE HHHHCCCCCCCCCCC | 33.36 | 19823750 | |
| 38 | Phosphorylation | ALETSSSSSDEEDEK HHHCCCCCCCCCCCC | 43.70 | 19795423 | |
| 39 | Phosphorylation | LETSSSSSDEEDEKD HHCCCCCCCCCCCCC | 51.49 | 19795423 | |
| 56 | Phosphorylation | EIEGLAASDDEQSGT HHHHHHCCCCCCCCC | 39.73 | 22890988 | |
| 61 | Phosphorylation | AASDDEQSGTHKIKR HCCCCCCCCCHHHHC | 43.54 | 22890988 | |
| 63 | Phosphorylation | SDDEQSGTHKIKRLN CCCCCCCCHHHHCCC | 25.83 | 22890988 | |
| 118 | Acetylation | FAQFGDLKEVRLARN HHHHCCHHHHHHHHC | 59.93 | 24489116 | |
| 169 | Acetylation | LQVRVLPKGAKIEKL EEEEECCCCCCHHHH | 68.30 | 25381059 | |
| 187 | Acetylation | KKRVLVEKGITKPVK CHHHHHHCCCCHHHH | 48.40 | 24489116 | |
| 191 | Acetylation | LVEKGITKPVKQLKD HHHCCCCHHHHHHHH | 45.98 | 25381059 | |
| 197 | Acetylation | TKPVKQLKDNMKQKH CHHHHHHHHHHHHHH | 44.56 | 25381059 | |
| 213 | Acetylation | ERIKKLAKSGIEFKW HHHHHHHHCCCCCCC | 60.70 | 25381059 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NOP15_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NOP15_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NOP15_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...