UniProt ID | IMP4_YEAST | |
---|---|---|
UniProt AC | P53941 | |
Protein Name | U3 small nucleolar ribonucleoprotein protein IMP4 | |
Gene Name | IMP4 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 290 | |
Subcellular Localization | Nucleus, nucleolus . | |
Protein Description | Required for the early cleavages at sites A0, A1 and A2 during 18S ribosomal pre-RNA processing.. | |
Protein Sequence | MLRRQARERREYLYRKAQELQDSQLQQKRQIIKQALAQGKPLPKELAEDESLQKDFRYDQSLKESEEADDLQVDDEYAATSGIMDPRIIVTTSRDPSTRLSQFAKEIKLLFPNAVRLNRGNYVMPNLVDACKKSGTTDLVVLHEHRGVPTSLTISHFPHGPTAQFSLHNVVMRHDIINAGNQSEVNPHLIFDNFTTALGKRVVCILKHLFNAGPKKDSERVITFANRGDFISVRQHVYVRTREGVEIAEVGPRFEMRLFELRLGTLENKDADVEWQLRRFIRTANKKDYL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
23 | Phosphorylation | KAQELQDSQLQQKRQ HHHHHCHHHHHHHHH | 21.60 | 30377154 | |
28 | Ubiquitination | QDSQLQQKRQIIKQA CHHHHHHHHHHHHHH | 33.05 | 23749301 | |
33 | Ubiquitination | QQKRQIIKQALAQGK HHHHHHHHHHHHCCC | 31.02 | 22817900 | |
40 | Ubiquitination | KQALAQGKPLPKELA HHHHHCCCCCCHHHH | 31.16 | 23749301 | |
51 | Phosphorylation | KELAEDESLQKDFRY HHHHCCHHHHHHHCC | 48.71 | 27214570 | |
54 | Acetylation | AEDESLQKDFRYDQS HCCHHHHHHHCCCHH | 65.22 | 24489116 | |
105 | Acetylation | TRLSQFAKEIKLLFP HHHHHHHHHHHHHCC | 62.35 | 24489116 | |
108 | Acetylation | SQFAKEIKLLFPNAV HHHHHHHHHHCCCCE | 39.98 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IMP4_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IMP4_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IMP4_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...