dbPTM

IMP4_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	IMP4_YEAST
UniProt AC	P53941
Protein Name	U3 small nucleolar ribonucleoprotein protein IMP4
Gene Name	IMP4
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	290
Subcellular Localization	Nucleus, nucleolus .
Protein Description	Required for the early cleavages at sites A0, A1 and A2 during 18S ribosomal pre-RNA processing..
Protein Sequence	MLRRQARERREYLYRKAQELQDSQLQQKRQIIKQALAQGKPLPKELAEDESLQKDFRYDQSLKESEEADDLQVDDEYAATSGIMDPRIIVTTSRDPSTRLSQFAKEIKLLFPNAVRLNRGNYVMPNLVDACKKSGTTDLVVLHEHRGVPTSLTISHFPHGPTAQFSLHNVVMRHDIINAGNQSEVNPHLIFDNFTTALGKRVVCILKHLFNAGPKKDSERVITFANRGDFISVRQHVYVRTREGVEIAEVGPRFEMRLFELRLGTLENKDADVEWQLRRFIRTANKKDYL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
23	Phosphorylation	KAQELQDSQLQQKRQ HHHHHCHHHHHHHHH	21.60	30377154
28	Ubiquitination	QDSQLQQKRQIIKQA CHHHHHHHHHHHHHH	33.05	23749301
33	Ubiquitination	QQKRQIIKQALAQGK HHHHHHHHHHHHCCC	31.02	22817900
40	Ubiquitination	KQALAQGKPLPKELA HHHHHCCCCCCHHHH	31.16	23749301
51	Phosphorylation	KELAEDESLQKDFRY HHHHCCHHHHHHHCC	48.71	27214570
54	Acetylation	AEDESLQKDFRYDQS HCCHHHHHHHCCCHH	65.22	24489116
105	Acetylation	TRLSQFAKEIKLLFP HHHHHHHHHHHHHCC	62.35	24489116
108	Acetylation	SQFAKEIKLLFPNAV HHHHHHHHHHCCCCE	39.98	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of IMP4_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of IMP4_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of IMP4_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MPP10_YEAST	MPP10	physical	10409734
MPP10_YEAST	MPP10	physical	14990745
FBRL_YEAST	NOP1	physical	15231838
EF1A_YEAST	TEF2	genetic	10485288
RPN2_YEAST	RPN2	physical	16429126
UTP13_YEAST	UTP13	physical	16429126
UTP10_YEAST	UTP10	physical	16429126
RPN3_YEAST	RPN3	physical	16429126
UTP17_YEAST	NAN1	physical	16429126
UTP4_YEAST	UTP4	physical	16429126
PBP2_YEAST	PBP2	physical	18719252
UTP8_YEAST	UTP8	physical	21724601
PWP2_YEAST	PWP2	physical	21724601
UTP21_YEAST	UTP21	physical	21724601
UTP13_YEAST	UTP13	physical	21724601
UTP22_YEAST	UTP22	physical	21724601
MPP10_YEAST	MPP10	physical	21724601
IMP3_YEAST	IMP3	physical	21724601
FBRL_YEAST	NOP1	physical	21724601
UTP20_YEAST	UTP20	physical	21724601
RRP5_YEAST	RRP5	physical	21724601
BMS1_YEAST	BMS1	physical	21724601
NAT10_YEAST	KRE33	physical	21724601
MRD1_YEAST	MRD1	physical	21724601
HAS1_YEAST	HAS1	physical	21724601
UTP10_YEAST	UTP10	physical	21724601
HSP72_YEAST	SSA2	physical	21724601
SEN1_YEAST	SEN1	physical	21724601
KIN1_YEAST	KIN1	physical	21724601
TYW1_YEAST	TYW1	physical	21724601
TAF5_YEAST	TAF5	genetic	27708008
NOP14_YEAST	NOP14	genetic	27708008
CAB5_YEAST	CAB5	genetic	27708008
GPI11_YEAST	GPI11	genetic	27708008
GPI8_YEAST	GPI8	genetic	27708008
UTP6_YEAST	UTP6	genetic	27708008
DIM1_YEAST	DIM1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of IMP4_YEAST

Related Literatures of Post-Translational Modification