IMP3_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IMP3_YEAST
• UniProt AC: P32899
• Protein Name: U3 small nucleolar ribonucleoprotein protein IMP3
• Gene Name: IMP3
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 183
• Subcellular Localization: Nucleus, nucleolus .
• Protein Description: Required for the early cleavages at sites A0, A1 and A2 during 18S ribosomal pre-RNA processing..
• Protein Sequence: MVRKLKHHEQKLLKKVDFLEWKQDQGHRDTQVMRTYHIQNREDYHKYNRICGDIRRLANKLSLLPPTDPFRRKHEQLLLDKLYAMGVLTTKSKISDLENKVTVSAICRRRLPVIMHRLKMAETIQDAVKFIEQGHVRVGPNLINDPAYLVTRNMEDYVTWVDNSKIKKTLLRYRNQIDDFDFS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
129	Acetylation	ETIQDAVKFIEQGHV HHHHHHHHHHHCCCC	42.20	24489116
165	Acetylation	VTWVDNSKIKKTLLR EEEECCHHHHHHHHH	65.87	25381059
183	Phosphorylation	QIDDFDFS------- CCCCCCCC-------	40.95	21440633

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of IMP3_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IMP3_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IMP3_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MPP10_YEAST	MPP10	physical	10409734
FBRL_YEAST	NOP1	physical	15231838
IMP4_YEAST	IMP4	physical	19482034
MPP10_YEAST	MPP10	physical	25005089

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.