| UniProt ID | SNU13_YEAST | |
|---|---|---|
| UniProt AC | P39990 | |
| Protein Name | 13 kDa ribonucleoprotein-associated protein | |
| Gene Name | SNU13 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 126 | |
| Subcellular Localization | Nucleus, nucleolus. | |
| Protein Description | Common component of the spliceosome and rRNA processing machinery. In association with the spliceosomal U4/U6.U5 tri-snRNP particle, required for splicing of pre-mRNA. In association with box C/D snoRNPs, required for processing of pre-ribosomal RNA (rRNA) and site-specific 2'-O-methylation of substrate RNAs. Essential for the accumulation and stability of U4 snRNA, U6 snRNA, and box C/D snoRNAs.. | |
| Protein Sequence | MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 34 | Ubiquitination | AANLRQLKKGANEAT HHHHHHHHHHHHHHH | 40.60 | 22817900 | |
| 35 | Ubiquitination | ANLRQLKKGANEATK HHHHHHHHHHHHHHH | 72.37 | 22817900 | |
| 94 | Phosphorylation | LGRACGVSRPVIAAS HHHHCCCCCCEEEEE | 19.02 | 27214570 | |
| 118 | Ubiquitination | KTQIYAVKDKIETLL HHHHEEEHHHHHHHC | 45.17 | 23749301 | |
| 120 | Acetylation | QIYAVKDKIETLLI- HHEEEHHHHHHHCC- | 36.40 | 22865919 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SNU13_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SNU13_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SNU13_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
