RSA1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RSA1_YEAST
• UniProt AC: Q08932
• Protein Name: Ribosome assembly 1 protein
• Gene Name: RSA1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 381
• Subcellular Localization: Nucleus.
• Protein Description: Involved in a late nucleoplasmic step of 60S ribosomal subunit assembly..
• Protein Sequence: MNYNNFENSKGDGHSRLPKPTYSGTLSDGYDESKIKRQKTDSAFNAAYSPHMYPNSPYYEGSWNTGYTPQLHHVAPHNQYFHPIQPSTQYNYTSPPNYTENYIPPVHQNISYAPALNLQKWPSSYCENTQALKNDKDYQTSISYEDVAIPTVKEIQLIEKNRGKDTFMNEISPVPSSKDQASAEPTEIPRKDPELANSNAEDDHNNLGLEDDDRDEQLESEGLGKVVLVPGTSIALITDEDVKKWREERKKMWLLKISNNKQKHMQEMGIKEDELKSQPSIFKESRKEKQFIQSIQNQVQRGNPKIDLNLKLIQREFANENSQLLDFIRELGDVGLLEYELSQQEKDVLFGSSEDNNKNHYKPNYKNRKPNLSRANFTRNK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MNYNNFEN -------CCCCCCCC	12.39	22814378
25	Phosphorylation	PKPTYSGTLSDGYDE CCCCCCCCCCCCCCH	19.69	27017623
27	Phosphorylation	PTYSGTLSDGYDESK CCCCCCCCCCCCHHH	28.91	23749301
141	Phosphorylation	NDKDYQTSISYEDVA CCCCCCCCCCHHHHC	8.26	28889911
160	Acetylation	KEIQLIEKNRGKDTF HEEEEHHHCCCCCCC	44.97	24489116
166	Phosphorylation	EKNRGKDTFMNEISP HHCCCCCCCCCCCCC	28.41	22369663
172	Phosphorylation	DTFMNEISPVPSSKD CCCCCCCCCCCCCCC	17.42	22369663
176	Phosphorylation	NEISPVPSSKDQASA CCCCCCCCCCCCCCC	50.70	22369663
177	Phosphorylation	EISPVPSSKDQASAE CCCCCCCCCCCCCCC	33.89	22369663
182	Phosphorylation	PSSKDQASAEPTEIP CCCCCCCCCCCCCCC	27.77	27214570
198	Phosphorylation	KDPELANSNAEDDHN CCHHHHCCCCCCCCC	31.63	28889911
352	Phosphorylation	EKDVLFGSSEDNNKN CCCEEECCCCCCCCC	24.18	30377154

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	RSP5	P39940	PMID:22199232

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RSA1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RSA1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SNU13_YEAST	SNU13	physical	18268104
NOP58_YEAST	NOP58	physical	18268104
PRP31_YEAST	PRP31	physical	18268104
PIH1_YEAST	PIH1	physical	18268104
RUVB1_YEAST	RVB1	physical	18268104
RUVB2_YEAST	RVB2	physical	18268104
SRS2_YEAST	SRS2	genetic	21459050
HIT1_YEAST	HIT1	physical	25170085
SNU13_YEAST	SNU13	physical	25170085
FBRL_YEAST	NOP1	physical	25170085
NOP56_YEAST	NOP56	physical	25170085
PIH1_YEAST	PIH1	genetic	25170085
SNU13_YEAST	SNU13	physical	27594683
BFA1_YEAST	BFA1	genetic	29056450
LTE1_YEAST	LTE1	genetic	29056450
CDC14_YEAST	CDC14	genetic	29056450

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"A multidimensional chromatography technology for in-depthphosphoproteome analysis.";
Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.;
Mol. Cell. Proteomics 7:1389-1396(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-172, AND MASSSPECTROMETRY.
PubMed: 18407956