dbPTM

HIT1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HIT1_YEAST
UniProt AC	P46973
Protein Name	Protein HIT1
Gene Name	HIT1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	164
Subcellular Localization
Protein Description
Protein Sequence	MVSSAVKCGICRGVDGKYKCPKCGVRYCSLKCYKDAAKHVHKESEQPRAGTEANVEVVNNDKIINSSLAMNKTLKTKAFDDIYQNSAELQELLKYNTVKFHLAKVYRILSSTVNDGSSGKMNSDLQKELAVNYLNTLRYGGIHYNEAIEEFCQILLDKLNAVKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
72	Acetylation	NSSLAMNKTLKTKAF CCHHHCCCCCCHHHH	41.99	25381059
117	Phosphorylation	SSTVNDGSSGKMNSD HCCCCCCCCCCCCHH	38.49	30377154
118	Phosphorylation	STVNDGSSGKMNSDL CCCCCCCCCCCCHHH	48.22	30377154

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HIT1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HIT1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HIT1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RSA1_YEAST	RSA1	physical	11283351
RSA1_YEAST	RSA1	physical	25170085
SNU13_YEAST	SNU13	physical	25170085
FBRL_YEAST	NOP1	physical	25170085
PIH1_YEAST	PIH1	genetic	25170085
DED1_YEAST	DED1	genetic	27708008
TBF1_YEAST	TBF1	genetic	27708008
SYIC_YEAST	ILS1	genetic	27708008
CDK1_YEAST	CDC28	genetic	27708008
CDC10_YEAST	CDC10	genetic	27708008
DAD1_YEAST	DAD1	genetic	27708008
RPB7_YEAST	RPB7	genetic	27708008
GDI1_YEAST	GDI1	genetic	27708008
CDC4_YEAST	CDC4	genetic	27708008
SDA1_YEAST	SDA1	genetic	27708008
RPF1_YEAST	RPF1	genetic	27708008
CDC12_YEAST	CDC12	genetic	27708008
SDO1_YEAST	SDO1	genetic	27708008
SEC10_YEAST	SEC10	genetic	27708008
DBP9_YEAST	DBP9	genetic	27708008
NOP2_YEAST	NOP2	genetic	27708008
BRX1_YEAST	BRX1	genetic	27708008
MAL12_YEAST	MAL12	genetic	27708008
HSL1_YEAST	HSL1	genetic	27708008
SAC1_YEAST	SAC1	genetic	27708008
DBP7_YEAST	DBP7	genetic	27708008
DYHC_YEAST	DYN1	genetic	27708008
POM33_YEAST	POM33	genetic	27708008
LDB18_YEAST	LDB18	genetic	27708008
ROM2_YEAST	ROM2	genetic	27708008
PSP2_YEAST	PSP2	genetic	27708008
TDA1_YEAST	TDA1	genetic	27708008
DYN3_YEAST	DYN3	genetic	27708008
PET8_YEAST	PET8	genetic	27708008
NST1_YEAST	NST1	genetic	27708008
REXO4_YEAST	REX4	genetic	27708008
YO098_YEAST	YOL098C	genetic	27708008
LIS1_YEAST	PAC1	genetic	27708008
YP068_YEAST	YPL068C	genetic	27708008
NEW1_YEAST	NEW1	genetic	27708008
SNU13_YEAST	SNU13	physical	27594683
RSA1_YEAST	RSA1	physical	27594683
LTE1_YEAST	LTE1	genetic	29056450
BFA1_YEAST	BFA1	genetic	29056450
CDC14_YEAST	CDC14	genetic	29056450
FBRL_YEAST	NOP1	physical	29056450
CND1_YEAST	YCS4	genetic	29056450

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HIT1_YEAST

Related Literatures of Post-Translational Modification