UniProt ID | YP068_YEAST | |
---|---|---|
UniProt AC | Q02749 | |
Protein Name | Uncharacterized protein YPL068C | |
Gene Name | YPL068C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 293 | |
Subcellular Localization | Nucleus . | |
Protein Description | ||
Protein Sequence | MHMQLRKRKRVDYSGRNQTSDPPSTTTAAVPSIIVPKKRKVVAQNMVSPAIRATTTTLGTSNIIIPKPLQRPKFHNSASLSSPDDDPEKISVLEVQKNLSNLIKRQQRLFYKDIHKPTLAGLKNFEMLRLPNDLKLLQNIVNLLYSFEQLNSDSKTRPVTTSKLKASSQAHSDKLKKMLAERKPPFSHPSHSGTAYHNDIIHEIANLHSINLVDLINLEVYNNNCHTNNTALQTTANSLTLNSIIKKLDKPILKERNNSLVWPHKSRFKAKRNQPSPGQSLINNTDITLYNDV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
13 | Phosphorylation | RKRKRVDYSGRNQTS HCCCCCCCCCCCCCC | 15.35 | 27017623 | |
25 | Phosphorylation | QTSDPPSTTTAAVPS CCCCCCCCCCCCCCE | 33.66 | 27017623 | |
27 | Phosphorylation | SDPPSTTTAAVPSII CCCCCCCCCCCCEEE | 16.83 | 27017623 | |
48 | Phosphorylation | VVAQNMVSPAIRATT HHHHHCCCHHHHHCC | 9.61 | 23749301 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YP068_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YP068_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YP068_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...