| UniProt ID | ERP1_YEAST | |
|---|---|---|
| UniProt AC | Q05359 | |
| Protein Name | Protein ERP1 | |
| Gene Name | ERP1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 219 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type I membrane protein . |
|
| Protein Description | Involved in vesicular protein trafficking.. | |
| Protein Sequence | MLLTSLLQVFACCLVLPAQVTAFYYYTSGAERKCFHKELSKGTLFQATYKAQIYDDQLQNYRDAGAQDFGVLIDIEETFDDNHLVVHQKGSASGDLTFLASDSGEHKICIQPEAGGWLIKAKTKIDVEFQVGSDEKLDSKGKATIDILHAKVNVLNSKIGEIRREQKLMRDREATFRDASEAVNSRAMWWIVIQLIVLAVTCGWQMKHLGKFFVKQKIL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 41 | Acetylation | CFHKELSKGTLFQAT EEEEHHCCCCEEEEE | 69.41 | 24489116 | |
| 91 | Phosphorylation | LVVHQKGSASGDLTF EEEEECCCCCCCEEE | 26.71 | 23749301 | |
| 97 | Phosphorylation | GSASGDLTFLASDSG CCCCCCEEEEECCCC | 22.73 | 23749301 | |
| 107 | Ubiquitination | ASDSGEHKICIQPEA ECCCCCCEEEEECCC | 34.66 | 17644757 | |
| 120 | Ubiquitination | EAGGWLIKAKTKIDV CCCCEEEEEEEEEEE | 41.48 | 17644757 | |
| 142 | Ubiquitination | EKLDSKGKATIDILH CCCCCCCCEEEEHHH | 46.20 | 17644757 | |
| 151 | Ubiquitination | TIDILHAKVNVLNSK EEEHHHHHHHHHHHH | 24.48 | 17644757 | |
| 151 | Acetylation | TIDILHAKVNVLNSK EEEHHHHHHHHHHHH | 24.48 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ERP1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ERP1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ERP1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
