UniProt ID | YIF1_YEAST | |
---|---|---|
UniProt AC | P53845 | |
Protein Name | Protein transport protein YIF1 | |
Gene Name | YIF1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 314 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Golgi apparatus membrane Multi-pass membrane protein . Cytoplasmic vesicle, COPII-coated vesicle . Also found in ER-derived COPII-coated vesicles. |
|
Protein Description | Required for fusion of ER-derived vesicles with the Golgi during ER-to-Golgi protein transport. May be involved in proper membrane localization of Rab GTPases.. | |
Protein Sequence | MSYNPYAYATSEQNGVNDRFSHTPQQQRPMQIPRNTPVNGQGNANMNANVNGSGGGFPFQDPRGSMAFQLGQSAFSNFIGQDNFNQFQETVNKATANAAGSQQISTYFQVSTRYVINKLKLILVPFLNGTKNWQRIMDSGNFLPPRDDVNSPDMYMPIMGLVTYILIWNTQQGLKGSFNPEDLYYKLSSTLAFVCLDLLILKLGLYLLIDSKIPSFSLVELLCYVGYKFVPLILAQLLTNVTMPFNLNILIKFYLFIAFGVFLLRSVKFNLLSRSGAEDDDIHVSISKSTVKKCNYFLFVYGFIWQNVLMWLMG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSYNPYAYA ------CCCCCCCCC | 33.35 | 22814378 | |
10 | Phosphorylation | YNPYAYATSEQNGVN CCCCCCCCCCCCCCC | 21.81 | 30377154 | |
21 | Phosphorylation | NGVNDRFSHTPQQQR CCCCCCCCCCCCCCC | 27.61 | 19779198 | |
23 | Phosphorylation | VNDRFSHTPQQQRPM CCCCCCCCCCCCCCC | 22.92 | 28889911 | |
36 | Phosphorylation | PMQIPRNTPVNGQGN CCCCCCCCCCCCCCC | 29.87 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YIF1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YIF1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YIF1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...