dbPTM

YPT10_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YPT10_YEAST
UniProt AC	P38146
Protein Name	GTP-binding protein YPT10
Gene Name	YPT10
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	199
Subcellular Localization	Cell membrane Lipid-anchor Cytoplasmic side .
Protein Description	Protein transport. Probably involved in vesicular traffic (By similarity). Specifically binds guanine nucleotides..
Protein Sequence	MEATIKVVLLGDSSVGKTSIVTRLKSGKFLAKHAATIGAAFITKTIEVPSNDSSTEKRIHMEIWDTAGQERYKSLVPMYYRDANIALIVFELGDVSSLQCAKTWFQDLQDRAQGTQVIIVGNKYDLVCEEHSGEVTIPAELQGLPYVAVSAKTGYNFDTLNKIIISLVPESQFKTLSKNNEQGNILEINKKKSGSGCIC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
57	Ubiquitination	SNDSSTEKRIHMEIW CCCCCCCEEEEEEEE	57.66	23749301
177	Phosphorylation	ESQFKTLSKNNEQGN HHHHCCCCCCCCCCC	38.27	23749301
178	Ubiquitination	SQFKTLSKNNEQGNI HHHCCCCCCCCCCCE	67.89	23749301
197	Geranylgeranylation	KKKSGSGCIC----- CCCCCCCCCC-----	2.84	-
199	Methylation	KSGSGCIC------- CCCCCCCC-------	5.47	-
199	Geranylgeranylation	KSGSGCIC------- CCCCCCCC-------	5.47	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YPT10_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YPT10_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YPT10_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GDI1_YEAST	GDI1	physical	11805837
RAEP_YEAST	MRS6	physical	11805837
GDI1_YEAST	GDI1	physical	11785952
PRA1_YEAST	YIP3	physical	11785952
YA11A_YEAST	YAR010C	physical	16554755
YP12A_YEAST	YAR010C	physical	16554755
RGP1_YEAST	RGP1	genetic	16269340
GDI1_YEAST	GDI1	physical	18467557
RAEP_YEAST	MRS6	physical	18719252
RV161_YEAST	RVS161	genetic	20093466
YD180_YEAST	YDL180W	genetic	20093466
EAF1_YEAST	EAF1	genetic	20093466
RV167_YEAST	RVS167	genetic	20093466
NEM1_YEAST	NEM1	genetic	20093466
CYT2_YEAST	CYT2	genetic	20093466
PPZ1_YEAST	PPZ1	genetic	20093466
AEP2_YEAST	AEP2	genetic	20093466
NST1_YEAST	NST1	genetic	20093466
SWS2_YEAST	SWS2	genetic	20093466
NOP12_YEAST	NOP12	genetic	20093466
DFG16_YEAST	DFG16	genetic	20093466
WHI2_YEAST	WHI2	genetic	20093466
VPH1_YEAST	VPH1	genetic	20093466
QCR2_YEAST	QCR2	genetic	20093466
GDI1_YEAST	GDI1	physical	22157956
YPT7_YEAST	YPT7	physical	22157956
YPT6_YEAST	YPT6	physical	22157956
VPS21_YEAST	VPS21	physical	22157956
VPH1_YEAST	VPH1	genetic	23891562
RIC1_YEAST	RIC1	genetic	23891562
MNE1_YEAST	MNE1	genetic	27708008
RU1A_YEAST	MUD1	genetic	27708008
NHP10_YEAST	NHP10	genetic	27708008
PMP3_YEAST	PMP3	genetic	27708008
RV167_YEAST	RVS167	genetic	27708008
SNF1_YEAST	SNF1	genetic	27708008
UBP3_YEAST	UBP3	genetic	27708008
RTF1_YEAST	RTF1	genetic	27708008
RL26B_YEAST	RPL26B	genetic	27708008
ASK10_YEAST	ASK10	genetic	27708008
QCR9_YEAST	QCR9	genetic	27708008
NEM1_YEAST	NEM1	genetic	27708008
UBI4P_YEAST	UBI4	genetic	27708008
ARPC3_YEAST	ARC18	genetic	27708008
AEP2_YEAST	AEP2	genetic	27708008
SWS2_YEAST	SWS2	genetic	27708008
NST1_YEAST	NST1	genetic	27708008
VPS27_YEAST	VPS27	genetic	27708008
PP2A4_YEAST	PPG1	genetic	27708008
NOP12_YEAST	NOP12	genetic	27708008
RTC1_YEAST	RTC1	genetic	27708008
WHI2_YEAST	WHI2	genetic	27708008
HAP5_YEAST	HAP5	genetic	27708008
MTHR1_YEAST	MET12	genetic	27708008
YME1_YEAST	YME1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YPT10_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-177, AND MASSSPECTROMETRY.	18407956 [Abstract]